You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08250
Secondary Accession Numbers
  • 13962
Name Lysyl oxidase homolog 2
Synonyms
  1. Lysyl oxidase-like protein 2
  2. Lysyl oxidase-related protein 2
  3. Lysyl oxidase-related protein WS9-14
Gene Name LOXL2
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (EMT) via interaction with SNAI1 and participates in repression of E-cadherin, probably by mediating deamination of histone H3. Also involved in E-cadherin repression following hypoxia, a hallmark of epithelial to mesenchymal transition believed to amplify tumor aggressiveness, suggesting that it may play a role in tumor progression. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation.
Pathways Not Available
Reactions
Peptidyl-L-lysyl-peptide + Oxygen + Water → peptidyl-allysyl-peptide + Ammonia + Hydrogen peroxide details
GO Classification
Biological Process
cell adhesion
epithelial to mesenchymal transition
histone modification
positive regulation of chondrocyte differentiation
protein deamination
sprouting angiogenesis
endothelial cell migration
negative regulation of transcription, DNA-dependent
collagen fibril organization
aging
transcription, DNA-dependent
endothelial cell proliferation
response to hypoxia
Cellular Component
chromosome
nucleus
basement membrane
extracellular space
membrane
Component
membrane
cell part
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
receptor activity
transmembrane receptor activity
scavenger receptor activity
oxidoreductase activity, acting on the ch-nh2 group of donors
oxidoreductase activity, acting on the ch-nh2 group of donors, oxygen as acceptor
molecular transducer activity
signal transducer activity
oxidoreductase activity
copper ion binding
Molecular Function
electron carrier activity
scavenger receptor activity
protein-lysine 6-oxidase activity
methylated histone residue binding
chromatin binding
copper ion binding
transcription corepressor activity
Process
metabolic process
oxidation reduction
Cellular Location
  1. Secreted
  2. extracellular space (Potential)
Gene Properties
Chromosome Location 8
Locus 8p21.3
SNPs LOXL2
Gene Sequence
>2325 bp
ATGGAGAGGCCTCTGTGCTCCCACCTCTGCAGCTGCCTGGCTATGCTGGCCCTCCTGTCC
CCCCTGAGCCTGGCACAGTATGACAGCTGGCCCCATTACCCCGAGTACTTCCAGCAACCG
GCTCCTGAGTATCACCAGCCCCAGGCCCCCGCCAACGTGGCCAAGATTCAGCTGCGCCTG
GCTGGGCAGAAGAGGAAGCACAGCGAGGGCCGGGTGGAGGTGTACTATGATGGCCAGTGG
GGCACCGTGTGCGATGACGACTTCTCCATCCACGCTGCCCACGTCGTCTGCCGGGAGCTG
GGCTACGTGGAGGCCAAGTCCTGGACTGCCAGCTCCTCCTACGGCAAGGGAGAAGGGCCC
ATCTGGTTAGACAATCTCCACTGTACTGGCAACGAGGCGACCCTTGCAGCATGCACCTCC
AATGGCTGGGGCGTCACTGACTGCAAGCACACGGAGGATGTCGGTGTGGTGTGCAGCGAC
AAAAGGATTCCTGGGTTCAAATTTGACAATTCGTTGATCAACCAGATAGAGAACCTGAAT
ATCCAGGTGGAGGACATTCGGATTCGAGCCATCCTCTCAACCTACCGCAAGCGCACCCCA
GTGATGGAGGGCTACGTGGAGGTGAAGGAGGGCAAGACCTGGAAGCAGATCTGTGACAAG
CACTGGACGGCCAAGAATTCCCGCGTGGTCTGCGGCATGTTTGGCTTCCCTGGGGAGAGG
ACATACAATACCAAAGTGTACAAAATGTTTGCCTCACGGAGGAAGCAGCGCTACTGGCCA
TTCTCCATGGACTGCACCGGCACAGAGGCCCACATCTCCAGCTGCAAGCTGGGCCCCCAG
GTGTCACTGGACCCCATGAAGAATGTCACCTGCGAGAATGGGCTACCGGCCGTGGTGAGT
TGTGTGCCTGGGCAGGTCTTCAGCCCTGACGGACCCTCAAGATTCCGGAAAGCGTACAAG
CCAGAGCAACCCCTGGTGCGACTGAGAGGCGGTGCCTACATCGGGGAGGGCCGCGTGGAG
GTGCTCAAAAATGGAGAATGGGGGACCGTCTGCGACGACAAGTGGGACCTGGTGTCGGCC
AGTGTGGTCTGCAGAGAGCTGGGCTTTGGGAGTGCCAAAGAGGCAGTCACTGGCTCCCGA
CTGGGGCAAGGGATCGGACCCATCCACCTCAACGAGATCCAGTGCACAGGCAATGAGAAG
TCCATTATAGACTGCAAGTTCAATGCCGAGTCTCAGGGCTGCAACCACGAGGAGGATGCT
GGTGTGAGATGCAACACCCCTGCCATGGGCTTGCAGAAGAAGCTGCGCCTGAACGGCGGC
CGCAATCCCTACGAGGGCCGAGTGGAGGTGCTGGTGGAGAGAAACGGGTCCCTTGTGTGG
GGGATGGTGTGTGGCCAAAACTGGGGCATCGTGGAGGCCATGGTGGTCTGCCGCCAGCTG
GGCCTGGGATTCGCCAGCAACGCCTTCCAGGAGACCTGGTATTGGCACGGAGATGTCAAC
AGCAACAAAGTGGTCATGAGTGGAGTGAAGTGCTCGGGAACGGAGCTGTCCCTGGCGCAC
TGCCGCCACGACGGGGAGGACGTGGCCTGCCCCCAGGGCGGAGTGCAGTACGGGGCCGGA
GTTGCCTGCTCAGAAACCGCCCCTGACCTGGTCCTCAATGCGGAGATGGTGCAGCAGACC
ACCTACCTGGAGGACCGGCCCATGTTCATGCTGCAGTGTGCCATGGAGGAGAACTGCCTC
TCGGCCTCAGCCGCGCAGACCGACCCCACCACGGGCTACCGCCGGCTCCTGCGCTTCTCC
TCCCAGATCCACAACAATGGCCAGTCCGACTTCCGGCCCAAGAACGGCCGCCACGCGTGG
ATCTGGCACGACTGTCACAGGCACTACCACAGCATGGAGGTGTTCACCCACTATGACCTG
CTGAACCTCAATGGCACCAAGGTGGCAGAGGGCCACAAGGCCAGCTTCTGCTTGGAGGAC
ACAGAATGTGAAGGAGACATCCAGAAGAATTACGAGTGTGCCAACTTCGGCGATCAGGGC
ATCACCATGGGCTGCTGGGACATGTACCGCCATGACATCGACTGCCAGTGGGTTGACATC
ACTGACGTGCCCCCTGGAGACTACCTGTTCCAGGTTGTTATTAACCCCAACTTCGAGGTT
GCAGAATCCGATTACTCCAACAACATCATGAAATGCAGGAGCCGCTATGACGGCCACCGC
ATCTGGATGTACAACTGCCACATAGGTGGTTCCTTCAGCGAAGAGACGGAAAAAAAGTTT
GAGCACTTCAGCGGGCTCTTAAACAACCAGCTGTCCCCGCAGTAA
Protein Properties
Number of Residues 774
Molecular Weight 86724.305
Theoretical pI 6.38
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Lysyl oxidase homolog 2
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ
GenBank ID Protein 4505011
UniProtKB/Swiss-Prot ID Q9Y4K0
UniProtKB/Swiss-Prot Entry Name LOXL2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002318.2
GeneCard ID LOXL2
GenAtlas ID LOXL2
HGNC ID HGNC:6666
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Saito H, Papaconstantinou J, Sato H, Goldstein S: Regulation of a novel gene encoding a lysyl oxidase-related protein in cellular adhesion and senescence. J Biol Chem. 1997 Mar 28;272(13):8157-60. [PubMed:9079631 ]
  3. Jourdan-Le Saux C, Tronecker H, Bogic L, Bryant-Greenwood GD, Boyd CD, Csiszar K: The LOXL2 gene encodes a new lysyl oxidase-like protein and is expressed at high levels in reproductive tissues. J Biol Chem. 1999 Apr 30;274(18):12939-44. [PubMed:10212285 ]