You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08251
Secondary Accession Numbers
  • 13963
Name Lysyl oxidase homolog 3
Synonyms
  1. Lysyl oxidase-like protein 3
Gene Name LOXL3
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
receptor activity
transmembrane receptor activity
scavenger receptor activity
oxidoreductase activity, acting on the ch-nh2 group of donors
oxidoreductase activity, acting on the ch-nh2 group of donors, oxygen as acceptor
molecular transducer activity
signal transducer activity
oxidoreductase activity
copper ion binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Secreted
  2. extracellular space (Potential)
Gene Properties
Chromosome Location Chromosome:2
Locus 2p13
SNPs LOXL3
Gene Sequence
>2262 bp
ATGCGACCTGTCAGTGTCTGGCAGTGGAGCCCCTGGGGGCTGCTGCTGTGCCTGCTGTGC
AGTTCGTGCTTGGGGTCTCCGTCCCCTTCCACGGGCCCTGAGAAGAAGGCCGGGAGCCAG
GGGCTTCGGTTCCGGCTGGCTGGCTTCCCCAGGAAGCCCTACGAGGGCCGCGTGGAGATA
CAGCGAGCTGGTGAATGGGGCACCATCTGCGATGATGACTTCACGCTGCAGGCTGCCCAC
ATCCTCTGCCGGGAGCTGGGCTTCACAGAGGCCACAGGCTGGACCCACAGTGCCAAATAT
GGCCCTGGAACAGGCCGCATCTGGCTGGACAACTTGAGCTGCAGTGGGACCGAGCAGAGT
GTGACTGAATGTGCCTCCCGGGGCTGGGGGAACAGTGACTGTACGCACGATGAGGATGCT
GGGGTCATCTGCAAAGACCAGCGCCTCCCTGGCTTCTCGGACTCCAATGTCATTGAGGTA
GAGCATCACCTGCAAGTGGAGGAGGTGCGAATTCGACCCGCCGTTGGGTGGGGCAGACGA
CCCCTGCCCGTGACGGAGGGGCTGGTGGAAGTCAGGCTTCCTGACGGCTGGTCGCAAGTG
TGCGACAAAGGCTGGAGCGCCCACAACAGCCACGTGGTCTGCGGGATGCTGGGCTTCCCC
AGCGAAAAGAGGGTCAACGCGGCCTTCTACAGGCTGCTAGCCCAACGGCAGCAACACTCC
TTTGGTCTGCATGGGGTGGCGTGCGTGGGCACGGAGGCCCACCTCTCCCTCTGTTCCCTG
GAGTTCTATCGTGCCAATGACACCGCCAGGTGCCCTGGGGGGGGCCCTGCAGTGGTGAGC
TGTGTGCCAGGCCCTGTCTACGCGGCATCCAGTGGCCAGAAGAAGCAACAACAGTCGAAG
CCTCAGGGGGAGGCCCGTGTCCGTCTAAAGGGCGGCGCCCACCCTGGAGAGGGCCGGGTA
GAAGTCCTGAAGGCCAGCACATGGGGCACAGTCTGTGACCGCAAGTGGGACCTGCATGCA
GCCAGCGTGGTGTGTCGGGAGCTGGGCTTCGGGAGTGCTCGAGAAGCTCTGAGTGGCGCT
CGCATGGGGCAGGGCATGGGTGCTATCCACCTGAGTGAAGTTCGCTGCTCTGGACAGGAG
CTCTCCCTCTGGAAGTGCCCCCACAAGAACATCACAGCTGAGGATTGTTCACATAGCCAG
GATGCCGGGGTCCGGTGCAACCTACCTTACACTGGGGCAGAGACCAGGATCCGACTCAGT
GGGGGCCGCAGCCAACATGAGGGGCGAGTCGAGGTGCAAATAGGGGGACCTGGGCCCCTT
CGCTGGGGCCTCATCTGTGGGGATGACTGGGGGACCCTGGAGGCCATGGTGGCCTGTAGG
CAACTGGGTCTGGGCTACGCCAACCACGGCCTGCAGGAGACCTGGTACTGGGACTCTGGG
AATATAACAGAGGTGGTGATGAGTGGAGTGCGCTGCACAGGGACTGAGCTGTCCCTGGAT
CAGTGTGCCCATCATGGCACCCACATCACCTGCAAGAGGACAGGGACCCGCTTCACTGCT
GGAGTCATCTGTTCTGAGACTGCATCAGATCTGTTGCTGCACTCAGCACTGGTGCAGGAG
ACCGCCTACATCGAAGACCGGCCCCTGCATATGTTGTACTGTGCTGCGGAAGAGAACTGC
CTGGCCAGCTCAGCCCGCTCAGCCAACTGGCCCTATGGTCACCGGCGTCTGCTCCGATTC
TCCTCCCAGATCCACAACCTGGGACGAGCTGACTTCAGGCCCAAGGCTGGGCGCCACTCC
TGGGTGTGGCACGAGTGCCATGGGCATTACCACAGCATGGACATCTTCACTCACTATGAT
ATCCTCACCCCAAATGGCACCAAGGTGGCTGAGGGCCACAAAGCTAGTTTCTGTCTCGAA
GACACTGAGTGTCAGGAGGATGTCTCCAAGCGGTATGAGTGTGCCAACTTTGGAGAGCAA
GGCATCACTGTGGGTTGCTGGGATCTCTACCGGCATGACATTGACTGTCAGTGGATTGAC
ATCACGGATGTGAAGCCAGGAAACTACATTCTCCAGGTTGTCATCAACCCAAACTTTGAA
GTAGCAGAGAGTGACTTTACCAACAATGCAATGAAATGTAACTGCAAATATGATGGACAT
AGAATCTGGGTGCACAACTGCCACATTGGTGATGCCTTCAGTGAAGAGGCCAACAGGAGG
TTTGAACGCTACCCTGGCCAGACCAGCAACCAGATTATCTAA
Protein Properties
Number of Residues 753
Molecular Weight 83165.9
Theoretical pI 6.85
Pfam Domain Function
Signals
  • 1-25
Transmembrane Regions
  • None
Protein Sequence
>Lysyl oxidase homolog 3
MRPVSVWQWSPWGLLLCLLCSSCLGSPSPSTGPEKKAGSQGLRFRLAGFPRKPYEGRVEI
QRAGEWGTICDDDFTLQAAHILCRELGFTEATGWTHSAKYGPGTGRIWLDNLSCSGTEQS
VTECASRGWGNSDCTHDEDAGVICKDQRLPGFSDSNVIEVEHHLQVEEVRIRPAVGWGRR
PLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHS
FGLHGVACVGTEAHLSLCSLEFYRANDTARCPGGGPAVVSCVPGPVYAASSGQKKQQQSK
PQGEARVRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFGSAREALSGA
RMGQGMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS
GGRSQHEGRVEVQIGGPGPLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDSG
NITEVVMSGVRCTGTELSLDQCAHHGTHITCKRTGTRFTAGVICSETASDLLLHSALVQE
TAYIEDRPLHMLYCAAEENCLASSARSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRHS
WVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQ
GITVGCWDLYRHDIDCQWIDITDVKPGNYILQVVINPNFEVAESDFTNNAMKCNCKYDGH
RIWVHNCHIGDAFSEEANRRFERYPGQTSNQII
GenBank ID Protein 14009597
UniProtKB/Swiss-Prot ID P58215
UniProtKB/Swiss-Prot Entry Name LOXL3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF282619
GeneCard ID LOXL3
GenAtlas ID LOXL3
HGNC ID HGNC:13869
References
General References
  1. Maki JM, Kivirikko KI: Cloning and characterization of a fourth human lysyl oxidase isoenzyme. Biochem J. 2001 Apr 15;355(Pt 2):381-7. [PubMed:11284725 ]
  2. Jourdan-Le Saux C, Tomsche A, Ujfalusi A, Jia L, Csiszar K: Central nervous system, uterus, heart, and leukocyte expression of the LOXL3 gene, encoding a novel lysyl oxidase-like protein. Genomics. 2001 Jun 1;74(2):211-8. [PubMed:11386757 ]
  3. Huang Y, Dai J, Tang R, Zhao W, Zhou Z, Wang W, Ying K, Xie Y, Mao Y: Cloning and characterization of a human lysyl oxidase-like 3 gene (hLOXL3). Matrix Biol. 2001 Apr;20(2):153-7. [PubMed:11334717 ]