You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08258
Secondary Accession Numbers
  • 13970
Name Metalloreductase STEAP3
Synonyms
  1. Dudulin-2
  2. Six-transmembrane epithelial antigen of prostate 3
  3. Tumor suppressor-activated pathway protein 6
  4. hTSAP6
  5. hpHyde
  6. pHyde
Gene Name STEAP3
Protein Type Unknown
Biological Properties
General Function Involved in iron ion binding
Specific Function Endosomal ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells. Participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+). Can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. Uses NAD(+) as acceptor. May play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. Indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
electron carrier activity
iron ion binding
oxidoreductase activity
fad or fadh2 binding
Process
metabolic process
Cellular Location
  1. Endosome membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q14.2
SNPs STEAP3
Gene Sequence
>1467 bp
ATGCCAGAAGAGATGGACAAGCCACTGATCAGCCTCCACCTGGTGGACAGCGATAGTAGC
CTTGCCAAGGTCCCCGATGAGGCCCCCAAAGTGGGCATCCTGGGTAGCGGGGACTTTGCC
CGCTCCCTGGCCACACGCCTGGTGGGCTCTGGCTTCAAAGTGGTGGTGGGGAGCCGCAAC
CCCAAACGCACAGCCAGGCTGTTTCCCTCAGCGGCCCAAGTGACTTTCCAAGAGGAGGCA
GTGAGCTCCCCGGAGGTCATCTTTGTGGCTGTGTTCCGGGAGCACTACTCTTCACTGTGC
AGTCTCAGTGACCAGCTGGCGGGCAAGATCCTGGTGGATGTGAGCAACCCTACAGAGCAA
GAGCACCTTCAGCATCGTGAGTCCAATGCTGAGTACCTGGCCTCCCTCTTCCCCACTTGC
ACAGTGGTCAAGGCCTTCAATGTCATCTCTGCCTGGACCCTGCAGGCTGGCCCAAGGGAT
GGTAACAGGCAGGTGCCCATCTGCGGTGACCAGCCAGAAGCCAAGCGTGCTGTCTCGGAG
ATGGCGCTCGCCATGGGCTTCATGCCCGTGGACATGGGATCCCTGGCGTCAGCCTGGGAG
GTGGAGGCCATGCCCCTGCGCCTCCTCCCGGCCTGGAAGGTGCCCACCCTGCTGGCCCTG
GGGCTCTTCGTCTGCTTCTATGCCTACAACTTCGTCCGGGACGTTCTGCAGCCCTATGTG
CAGGAAAGCCAGAACAAGTTCTTCAAGCTGCCCGTGTCCGTGGTCAACACCACACTGCCG
TGCGTGGCCTACGTGCTGCTGTCACTCGTGTACTTGCCCGGCGTGCTGGCGGCTGCCCTG
CAGCTGCGGCGCGGCACCAAGTACCAGCGCTTCCCCGACTGGCTGGACCACTGGCTACAG
CACCGCAAGCAGATCGGGCTGCTCAGCTTCTTCTGCGCCGCCCTGCACGCCCTCTACAGC
TTCTGCTTGCCGCTGCGCCGCGCCCACCGCTACGACCTGGTCAACCTGGCAGTCAAGCAG
GTCTTGGCCAACAAGAGCCACCTCTGGGTGGAGGAGGAGGTCTGGCGGATGGAGATCTAC
CTCTCCCTGGGAGTGCTGGCCCTCGGCACGTTGTCCCTGCTGGCCGTGACCTCACTGCCG
TCCATTGCAAACTCGCTCAACTGGAGGGAGTTCAGCTTCGTTCAGTCCTCACTGGGCTTT
GTGGCCCTCGTGCTGAGCACACTGCACACGCTCACCTACGGCTGGACCCGCGCCTTCGAG
GAGAGCCGCTACAAGTTCTACCTGCCTCCCACCTTCACGCTCACGCTGCTGGTGCCCTGC
GTCGTCATCCTGGCCAAAGCCCTGTTTCTCCTGCCCTGCATCAGCCGCAGACTCGCCAGG
ATCCGGAGAGGCTGGGAGAGGGAGAGCACCATCAAGTTCACGCTGCCCACAGACCACGCC
CTGGCCGAGAAGACGAGCCACGTATGA
Protein Properties
Number of Residues 488
Molecular Weight 54600.1
Theoretical pI 8.74
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 208-228
  • 259-279
  • 305-325
  • 359-379
  • 391-411
  • 434-454
Protein Sequence
>Metalloreductase STEAP3
MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN
PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ
EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV
QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY
LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA
LAEKTSHV
GenBank ID Protein 56549147
UniProtKB/Swiss-Prot ID Q658P3
UniProtKB/Swiss-Prot Entry Name STEA3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001008410.1
GeneCard ID STEAP3
GenAtlas ID STEAP3
HGNC ID HGNC:24592
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Amzallag N, Passer BJ, Allanic D, Segura E, Thery C, Goud B, Amson R, Telerman A: TSAP6 facilitates the secretion of translationally controlled tumor protein/histamine-releasing factor via a nonclassical pathway. J Biol Chem. 2004 Oct 29;279(44):46104-12. Epub 2004 Aug 19. [PubMed:15319436 ]
  6. Passer BJ, Nancy-Portebois V, Amzallag N, Prieur S, Cans C, Roborel de Climens A, Fiucci G, Bouvard V, Tuynder M, Susini L, Morchoisne S, Crible V, Lespagnol A, Dausset J, Oren M, Amson R, Telerman A: The p53-inducible TSAP6 gene product regulates apoptosis and the cell cycle and interacts with Nix and the Myt1 kinase. Proc Natl Acad Sci U S A. 2003 Mar 4;100(5):2284-9. Epub 2003 Feb 26. [PubMed:12606722 ]
  7. Korkmaz CG, Korkmaz KS, Kurys P, Elbi C, Wang L, Klokk TI, Hammarstrom C, Troen G, Svindland A, Hager GL, Saatcioglu F: Molecular cloning and characterization of STAMP2, an androgen-regulated six transmembrane protein that is overexpressed in prostate cancer. Oncogene. 2005 Jul 21;24(31):4934-45. [PubMed:15897894 ]
  8. Steiner MS, Zhang X, Wang Y, Lu Y: Growth inhibition of prostate cancer by an adenovirus expressing a novel tumor suppressor gene, pHyde. Cancer Res. 2000 Aug 15;60(16):4419-25. [PubMed:10969787 ]
  9. Porkka KP, Nupponen NN, Tammela TL, Vessella RL, Visakorpi T: Human pHyde is not a classical tumor suppressor gene in prostate cancer. Int J Cancer. 2003 Sep 20;106(5):729-35. [PubMed:12866033 ]
  10. Coulouarn C, Derambure C, Lefebvre G, Daveau R, Hiron M, Scotte M, Francois A, Daveau M, Salier JP: Global gene repression in hepatocellular carcinoma and fetal liver, and suppression of dudulin-2 mRNA as a possible marker for the cirrhosis-to-tumor transition. J Hepatol. 2005 Jun;42(6):860-9. Epub 2005 Apr 11. [PubMed:15885357 ]
  11. Ohgami RS, Campagna DR, Greer EL, Antiochos B, McDonald A, Chen J, Sharp JJ, Fujiwara Y, Barker JE, Fleming MD: Identification of a ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells. Nat Genet. 2005 Nov;37(11):1264-9. Epub 2005 Oct 16. [PubMed:16227996 ]
  12. Yu X, Harris SL, Levine AJ: The regulation of exosome secretion: a novel function of the p53 protein. Cancer Res. 2006 May 1;66(9):4795-801. [PubMed:16651434 ]