Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08261
Secondary Accession Numbers
  • 13973
Name Apoptosis-inducing factor 2
Synonyms
  1. Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
  2. Apoptosis-inducing factor-like mitochondrion-associated inducer of death
  3. p53-responsive gene 3 protein
Gene Name AIFM2
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Oxidoreductase, which may play a role in mediating a TP53/p53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
oxidoreductase activity
fad or fadh2 binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Cytoplasm
  2. Mitochondrion outer membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 10q22.1
SNPs AIFM2
Gene Sequence
>1122 bp
ATGGGGTCCCAGGTCTCGGTGGAATCGGGAGCTCTGCACGTGGTGATTGTGGGTGGGGGC
TTTGGCGGGATCGCAGCAGCCAGCCAGCTGCAGGCCCTGAACGTCCCCTTCATGCTGGTG
GACATGAAGGACTCCTTCCACCACAATGTGGCTGCTCTCCGAGCCTCCGTGGAGACAGGG
TTCGCCAAAAAGACATTCATTTCTTACTCGGTGACTTTCAAGGACAACTTCCGGCAGGGG
CTAGTAGTGGGGATAGACCTGAAGAACCAGATGGTGCTGCTGCAGGGTGGCGAGGCCCTG
CCCTTCTCTCATCTTATCCTGGCCACGGGCAGCACTGGGCCCTTCCCGGGCAAGTTTAAT
GAGGTTTCCAGCCAGCAGGCCGCTATCCAGGCCTATGAGGACATGGTGAGGCAGGTCCAG
CGCTCACGGTTCATCGTGGTGGTGGGAGGAGGCTCGGCTGGAGTGGAGATGGCAGCAGAG
ATTAAAACAGAATATCCTGAGAAAGAGGTCACTCTCATTCACTCCCAAGTGGCCCTGGCT
GACAAGGAGCTCCTGCCCTCCGTCCGGCAGGAAGTGAAGGAGATCCTCCTCCGGAAGGGC
GTGCAGCTGCTGCTGAGTGAGCGGGTGAGCAATCTGGAGGAGCTGCCTCTCAATGAGTAT
CGAGAGTACATCAAAGTGCAGACGGACAAAGGCACAGAGGTGGCCACCAACCTGGTGATT
CTCTGCACCGGCATCAAGATCAACAGCTCCGCCTACCGCAAAGCATTTGAGAGCAGACTA
GCCAGCAGTGGTGCTCTGAGAGTGAACGAGCACCTCCAGGTGGAGGGCCACAGCAACGTC
TACGCCATTGGTGACTGTGCCGACGTGAGGACGCCCAAGATGGCCTATCTTGCCGGCCTC
CACGCCAACATCGCCGTGGCCAACATCGTCAACTCTGTGAAGCAGCGGCCTCTCCAGGCC
TACAAGCCGGGTGCACTGACGTTCCTCCTGTCCATGGGGAGAAATGACGGTGTGGGCCAA
ATCAGTGGCTTCTATGTGGGCCGGCTCATGGTTCGGCTGACCAAGAGCCGGGACCTGTTC
GTCTCTACGAGCTGGAAAACCATGAGGCAGTCTCCACCTTGA
Protein Properties
Number of Residues 373
Molecular Weight 40526.4
Theoretical pI 9.55
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 7-27
Protein Sequence
>Apoptosis-inducing factor 2
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMRQSPP
GenBank ID Protein 18478646
UniProtKB/Swiss-Prot ID Q9BRQ8
UniProtKB/Swiss-Prot Entry Name AIFM2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF337957
GeneCard ID AIFM2
GenAtlas ID AIFM2
HGNC ID HGNC:21411
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Ohiro Y, Garkavtsev I, Kobayashi S, Sreekumar KR, Nantz R, Higashikubo BT, Duffy SL, Higashikubo R, Usheva A, Gius D, Kley N, Horikoshi N: A novel p53-inducible apoptogenic gene, PRG3, encodes a homologue of the apoptosis-inducing factor (AIF). FEBS Lett. 2002 Jul 31;524(1-3):163-71. [PubMed:12135761 ]
  6. Wu M, Xu LG, Li X, Zhai Z, Shu HB: AMID, an apoptosis-inducing factor-homologous mitochondrion-associated protein, induces caspase-independent apoptosis. J Biol Chem. 2002 Jul 12;277(28):25617-23. Epub 2002 Apr 29. [PubMed:11980907 ]
  7. Wu M, Xu LG, Su T, Tian Y, Zhai Z, Shu HB: AMID is a p53-inducible gene downregulated in tumors. Oncogene. 2004 Sep 2;23(40):6815-9. [PubMed:15273740 ]
  8. Marshall KR, Gong M, Wodke L, Lamb JH, Jones DJ, Farmer PB, Scrutton NS, Munro AW: The human apoptosis-inducing protein AMID is an oxidoreductase with a modified flavin cofactor and DNA binding activity. J Biol Chem. 2005 Sep 2;280(35):30735-40. Epub 2005 Jun 15. [PubMed:15958387 ]