You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08264
Secondary Accession Numbers
  • 13976
Name Lysine-specific histone demethylase 1B
Synonyms
  1. Flavin-containing amine oxidase domain-containing protein 1
  2. Lysine-specific histone demethylase 2
Gene Name KDM1B
Protein Type Unknown
Biological Properties
General Function Involved in zinc ion binding
Specific Function Histone demethylase that demethylates 'Lys-4' of histone H3, a specific tag for epigenetic transcriptional activation, thereby acting as a corepressor. Required for de novo DNA methylation of a subset of imprinted genes during oogenesis. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Demethylates both mono- and di-methylated 'Lys-4' of histone H3. Has no effect on tri- methylated 'Lys-4', mono-, di- or tri-methylated 'Lys-9', mono-, di- or tri-methylated 'Lys-27', mono-, di- or tri-methylated 'Lys- 36' of histone H3, or on mono-, di- or tri-methylated 'Lys-20' of histone H4
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:6
Locus 6p22.3
SNPs KDM1B
Gene Sequence
>2475 bp
ATGGCAACCCCACGGGGGAGGACAAAGAAAAAAGCATCTTTTGATCATTCTCCGGATAGC
CTTCCTTTGAGGAGCTCCGGTAGGCAGGTAGTGGCGAAGAAGAAAGCAACAGAGACAACA
GATGAGGATGAAGATGGTGGGTCAGAGAAGAAGTACAGGAAATGTGAAAAGGCAGGCTGT
ACGGCAACATGTCCTGTGTGCTTTGCGAGTGCTTCTGAAAGATGTGCCAAAAATGGCTAC
ACCTCCCGATGGTATCATCTCTCCTGTGGGGAACATTTCTGTAATGAATGCTTTGACCAT
TACTACAGAAGCCATAAGGATGGATATGACAAATATACTACATGGAAAAAAATATGGACT
AGCAATGGCAAAACTGAACCTAGTCCCAAAGCTTTCATGGCAGACCAGCAACTCCCCTAC
TGGGTTCAGTGTACAAAACCTGAGTGTAGAAAATGGAGGCAGCTTACCAAGGAAATCCAG
CTTACTCCACAGATAGCCAAGACTTATCGATGTGGTATGAAACCAAATACTGCTATTAAG
CCTGAGACCTCAGATCATTGTTCCCTTCCAGAGGATCTAAGAGTATTGGAAGTTTCCAAC
CATTGGTGGTACTCTATGCTCATCCTACCTCCTTTGCTGAAAGACAGCGTGGCAGCGCCC
CTGCTGTCTGCCTACTACCCCGACTGTGTTGGCATGAGCCCCTCCTGCACCAGCACAAAC
CGTGCCGCTGCCATTGGCGATGCCAGCCCTGGGAAGCTGGAGCACTCCAAGGCTGCCCTC
TCCGTGCACGTTCCAGGCATGAACCGATACTTCCAGCCTTTCTACCAGCCCAATGAGTGT
GGCAAAGCCCTCTGTGTGAGGCCGGATGTGATGGAACTGGATGAGCTCTATGAGTTTCCA
GAGTATTCCCGAGACCCCACCATGTACCTGGCTTTGAGAAACCTCATCCTCGCACTGTGG
TATACTAACTGCAAAGAAGCTCTTACTCCTCAGAAATGTATTCCTCACATCATCGTCCGG
GGTCTTGTGCGTATTCGATGCGTTCAGGAAGTGGAGAGAATACTGTATTTTATGACCAGA
AAAGGTCTCATCAACACTGGAGTTCTCAGCGTGGGAGCCGACCAGTATCTTCTCCCTAAG
GACTACCACAATAAATCAGTCATCATTATCGGGGCTGGTCCCGCAGGATTAGCAGCTGCT
AAGCAACTGCATAACTTTGGAATTAAGGTGACTGTCCTGGAAGCCAAAGACAGAATTGGA
GGCCGAGTCTGGGATGATAAATCTTTTAAAGGCGTCACAGTGGGAAGAGGAGCTCAGATT
GTCAATGGGTGTATTAACAACCCAGTAGCATTAATGTGTGAGCAACTTGGCATCAGCATG
CATAAATTTGGAGAAAGATGTGACTTAATTCAGGAAGGTGGAAGAATAACTGACCCCACT
ATTGACAAGCGCATGGATTTTCATTTTAATGCTCTCTTGGATGTTGTCTCTGAGTGGAGA
AAGGATAAGACTCAGCTCCAAGATGTCCCTTTAGGAGAAAAGATAGAAGAGATCTACAAG
GCATTTATTAAGGAATCTGGTATCCAATTCAGTGAGCTGGAGGGACAGGTGCTTCAGTTC
CATCTCAGTAACCTGGAGTACGCCTGTGGCAGCAACCTTCACCAGGTATCTGCTCGCTCC
TGGGACCACAATGAATTCTTTGCCCAGTTTGCTGGTGACCACACTCTGCTAACTCCCGGG
TACTCAGTGATAATTGAAAAACTGGCAGAAGGGCTCGACATTCGACTCAAATCTCCAGTG
CAGTGTATTGATTATTCTGGAGGTGAAGTGCAGGTTACCACTACAGATGGCACAGGGTAT
TCTGCACAAAAGGTATTAGTCACTGTACCACTGGCTTTACTACAGAAAGGTGCCATTCAG
TTTAATCCACCATTATCAGAGAAGAAGATGAAGGCTATCAACAGCTTAGGCGCAGGCATC
ATTGAAAAGATTGCCTTGCAATTTCCATATAGATTTTGGGACAGTAAAGTTCAAGGGGCT
GACTTTTTTGGTCACGTTCCTCCCAGTGCCAGCAAGCGAGGGCTTTTTGCCGTGTTCTAT
GATATGGATCCCCAGAAGAAGCACAGCGTGCTGATGTCTGTGATTGCCGGGGAGGCTGTC
GCGTCCGTGAGGACCCTGGAAGACAAACAGGTGCTGCAGCAGTGCATGGCCACGCTCCGG
GAGCTGTTCAAGGAGCAGGAGGTCCCAGATCCCACAAAGTATTTTGTCACTCGGTGGAGC
ACAGACCCATGGATCCAGATGGCATACAGTTTTGTGAAGACAGGTGGAAGTGGGGAGGCC
TATGATATCATTGCTGAAGACATTCAAGGAACCGTCTTTTTCGCTGGTGAGGCAACAAAC
AGGCATTTCCCACAAACTGTTACAGGGGCATATTTGAGTGGCGTTCGAGAAGCAAGCAAG
ATTGCAGCATTTTAA
Protein Properties
Number of Residues 823
Molecular Weight 92225.7
Theoretical pI 7.93
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Lysine-specific histone demethylase 1B
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRA
AATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEY
SRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKG
LINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTID
KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHL
SNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPQVQ
CIDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGII
EKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVA
SVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAY
DIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
GenBank ID Protein 297677229
UniProtKB/Swiss-Prot ID Q8NB78
UniProtKB/Swiss-Prot Entry Name KDM1B_HUMAN
PDB IDs Not Available
GenBank Gene ID XM_002816464
GeneCard ID KDM1B
GenAtlas ID KDM1B
HGNC ID HGNC:21577
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]