You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08284
Secondary Accession Numbers
  • 13996
Name Prenylcysteine oxidase-like
Synonyms Not Available
Gene Name PCYOX1L
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
Specific Function Probable oxidoreductase
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
oxidoreductase activity, acting on a sulfur group of donors
oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor
oxidoreductase activity
Process
metabolic process
cellular metabolic process
prenylcysteine metabolic process
prenylcysteine catabolic process
oxidation reduction
cellular amino acid derivative metabolic process
cellular amino acid and derivative metabolic process
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:5
Locus 5q32
SNPs PCYOX1L
Gene Sequence
>1485 bp
ATGGCCCGCGCAGCCCCGCTGCTCGCCGCGTTGACCGCGCTCCTCGCCGCCGCCGCTGCT
GGCGGAGATGCCCCGCCGGGCAAAATCGCGGTGGTTGGGGCTGGGATTGGGGGCTCTGCT
GTGGCCCATTTTCTCCAGCAGCACTTTGGACCTCGGGTGCAGATCGACGTGTACGAGAAG
GGAACCGTGGGTGGCCGCTTGGCCACCATCTCAGTCAACAAGCAGCACTATGAGAGCGGG
GCTGCCTCCTTCCACTCCCTGAGCCTGCACATGCAGGACTTCGTCAAGCTGCTGGGGCTG
AGGCACCGGCGCGAGGTGGTGGGCAGGAGCGCCATCTTCGGCGGGGAGCACTTCATGCTG
GAGGAGACTGACTGGTACCTGCTGAACCTCTTCCGCCTCTGGTGGCACTATGGCATCAGC
TTCCTGAGGCTGCAGATGTGGGTGGAGGAGGTCATGGAGAAGTTCATGAGGATCTATAAG
TACCAGGCCCACGGCTATGCCTTCTCGGGTGTGGAGGAGCTGCTCTACTCACTGGGGGAG
TCCACCTTTGTTAACATGACCCAGCACTCTGTGGCTGAGTCCCTGCTGCAGGTGGGCGTC
ACGCAGCGCTTTATTGATGATGTCGTTTCTGCTGTCCTGCGGGCCAGCTATGGCCAGTCA
GCAGCGATGCCCGCCTTTGCAGGAGCCATGTCACTAGCCGGGGCCCAAGGCAGCCTGTGG
TCTGTGGAAGGAGGCAATAAGCTGGTTTGTTCCGGTTTGCTGAAGCTCACCAAGGCCAAT
GTGATCCATGCCACAGTGACCTCTGTGACCCTGCACAGCACAGAGGGGAAAGCCCTGTAC
CAGGTGGCGTATGAGAATGAGGTAGGCAACAGCTCTGACTTCTATGACATCGTGGTCATC
GCCACCCCCCTGCACCTGGACAACAGCAGCAGCAACTTAACCTTTGCAGGCTTCCACCCG
CCCATTGATGACGTGCAGGGCTCTTTCCAGCCCACCGTCGTCTCCTTGGTCCACGGCTAC
CTCAACTCGTCCTACTTCGGTTTCCCAGACCCTAAGCTTTTCCCCTTTGCCAACATCCTT
ACCACAGATTTCCCCAGCTTCTTCTGCACTCTGGACAACATCTGCCCTGTCAACATCTCT
GCCAGCTTCCGGCGAAAGCAGCCCCAGGAGGCAGCTGTTTGGCGAGTCCAGTCCCCCAAG
CCCCTCTTTCGGACCCAGCTAAAGACCCTGTTCCGTTCCTATTACTCAGTGCAGACAGCT
GAGTGGCAGGCCCATCCCCTCTATGGCTCCCGCCCCACGCTCCCGAGGTTTGCACTCCAT
GACCAGCTCTTCTACCTCAATGCCCTGGAGTGGGCGGCCAGCTCCGTGGAGGTGATGGCC
GTGGCTGCCAAGAATGTGGCCTTGCTGGCTTACAACCGCTGGTACCAGGACCTAGACAAG
ATTGATCAAAAAGATTTGATGCACAAGGTCAAGACTGAACTGTGA
Protein Properties
Number of Residues 494
Molecular Weight 54646.1
Theoretical pI 7.34
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Prenylcysteine oxidase-like
MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLGLRHRREVVGRSAIFGGEHFML
EETDWYLLNLFRLWWHYGISFLRLQMWVEEVMEKFMRIYKYQAHGYAFSGVEELLYSLGE
STFVNMTQHSVAESLLQVGVTQRFIDDVVSAVLRASYGQSAAMPAFAGAMSLAGAQGSLW
SVEGGNKLVCSGLLKLTKANVIHATVTSVTLHSTEGKALYQVAYENEVGNSSDFYDIVVI
ATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPKLFPFANIL
TTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQLKTLFRSYYSVQTA
EWQAHPLYGSRPTLPRFALHDQLFYLNALEWAASSVEVMAVAAKNVALLAYNRWYQDLDK
IDQKDLMHKVKTEL
GenBank ID Protein 226442763
UniProtKB/Swiss-Prot ID Q8NBM8
UniProtKB/Swiss-Prot Entry Name PCYXL_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024028.3
GeneCard ID PCYOX1L
GenAtlas ID PCYOX1L
HGNC ID HGNC:28477
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161 ]
  4. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  5. Schmutz J, Martin J, Terry A, Couronne O, Grimwood J, Lowry S, Gordon LA, Scott D, Xie G, Huang W, Hellsten U, Tran-Gyamfi M, She X, Prabhakar S, Aerts A, Altherr M, Bajorek E, Black S, Branscomb E, Caoile C, Challacombe JF, Chan YM, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Lopez F, Lou Y, Martinez D, Medina C, Morgan J, Nandkeshwar R, Noonan JP, Pitluck S, Pollard M, Predki P, Priest J, Ramirez L, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wheeler J, Wu K, Yang J, Dickson M, Cheng JF, Eichler EE, Olsen A, Pennacchio LA, Rokhsar DS, Richardson P, Lucas SM, Myers RM, Rubin EM: The DNA sequence and comparative analysis of human chromosome 5. Nature. 2004 Sep 16;431(7006):268-74. [PubMed:15372022 ]