Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08285
Secondary Accession Numbers
  • 13997
Name [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
Synonyms
  1. PDP 2
  2. PDPC 2
  3. Pyruvate dehydrogenase phosphatase catalytic subunit 2
Gene Name PDP2
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex (By similarity).
Pathways Not Available
Reactions
[Pyruvate dehydrogenase (acetyl-transferring)] phosphate + Water → [pyruvate dehydrogenase (acetyl-transferring)] + Phosphate details
GO Classification
Biological Process
regulation of acetyl-CoA biosynthetic process from pyruvate
pyruvate metabolic process
protein dephosphorylation
Cellular Component
mitochondrial matrix
Component
macromolecular complex
protein complex
protein serine/threonine phosphatase complex
Function
phosphoprotein phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein serine/threonine phosphatase activity
Molecular Function
metal ion binding
[pyruvate dehydrogenase (lipoamide)] phosphatase activity
magnesium-dependent protein serine/threonine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs PDP2
Gene Sequence
>1590 bp
ATGTCAAGTACTGTGTCCTACTGGATCTTAAATTCTACAAGGAACAGCATTGCCACATTG
CAAGGGGGTAGACGCTTATACTCCAGGTATGTCTCAAATAGGAATAAATTAAAATGGAGG
CTCTTTTCCCGGGTGCCACCCACCCTAAACAGTTCCCCATGTGGTGGCTTTACTCTGTGC
AAAGCCTACAGACACACATCAACAGAGGAAGATGATTTTCACTTGCAACTCAGCCCTGAG
CAGATAAATGAAGTGCTTCGAGCTGGCGAGACAACCCACAAGATTCTTGACCTTGAAAGC
AGAGTCCCAAATTCAGTGTTGCGGTTTGAGAGCAACCAGCTGGCTGCCAATTCCCCAGTG
GAGGACCGGCGAGGTGTAGCCTCCTGCCTGCAAACCAATGGACTGATGTTTGGCATCTTC
GATGGACATGGTGGTCATGCATGTGCCCAAGCAGTGAGCGAGAGGCTCTTCTACTATGTG
GCAGTGTCCCTGATGTCCCACCAGACCCTGGAGCACATGGAGGGAGCTATGGAAAGCATG
AAACCCTTGCTGCCCATCCTGCATTGGCTCAAGCACCCAGGGGACAGTATCTACAAGGAT
GTCACATCTGTGCATCTTGACCACCTCCGTGTCTATTGGCAGGAACTGCTTGATTTGCAC
ATGGAAATGGGACTAAGCATTGAAGAAGCATTAATGTACTCCTTCCAGAGACTGGATTCT
GACATCTCGCTGGAAATCCAGGCCCCCCTGGAAGATGAGGTGACAAGGAACCTGTCACTC
CAGGTTGCTTTCTCTGGGGCAACAGCTTGCATGGCCCATGTTGATGGAATTCACTTGCAC
GTGGCAAATGCTGGTGACTGCCGAGCCATCCTTGGTGTCCAAGAGGACAATGGCATGTGG
TCTTGTCTGCCCCTTACACGTGACCACAATGCCTGGAACCAGGCCGAGCTGTCCCGGCTA
AAGAGGGAGCACCCTGAGTCAGAGGACAGGACGATCATCATGGAGGACAGGCTACTGGGC
GTCCTCATCCCCTGCAGGGCCTTTGGGGATGTTCAGCTGAAGTGGAGTAAAGAGTTGCAG
CGCAGCATTCTGGAGAGGGGCTTCAATACCGAGGCCCTCAACATTTACCAGTTCACACCC
CCACACTACTACACTCCACCCTACCTGACTGCTGAGCCTGAGGTCACATACCACAGGCTG
AGGCCCCAGGATAAGTTCCTTGTGCTGGCCTCAGATGGCCTGTGGGACATGCTGAGCAAT
GAGGACGTGGTAAGGCTGGTGGTGGGGCACCTGGCTGAGGCAGATTGGCACAAGACAGAC
CTGGCCCAGAGACCCGCCAACTTGGGGCTCATGCAGAGCCTGCTGCTGCAGAGGAAAGCC
AGCGGGCTCCACGAGGCTGACCAAAATGCAGCCACGCGGCTGATCAGACATGCCATCGGG
AACAATGAGTATGGGGAGATGGAGGCAGAGCGGCTGGCGGCGATGCTGACATTGCCAGAG
GACTTGGCGAGGATGTACAGGGATGATATCACTGTCACTGTGGTGTATTTTAACTCAGAA
TCAATCGGTGCATATTACAAGGGGGGTTAA
Protein Properties
Number of Residues 529
Molecular Weight 59977.46
Theoretical pI 6.081
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
MSSTVSYWILNSTRNSIATLQGGRRLYSRYVSNRNKLKWRLFSRVPPTLNSSPCGGFTLC
KAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPV
EDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESM
KPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDS
DISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMW
SCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQ
RSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSN
EDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIG
NNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
GenBank ID Protein 41349497
UniProtKB/Swiss-Prot ID Q9P2J9
UniProtKB/Swiss-Prot Entry Name PDP2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020786.1
GeneCard ID PDP2
GenAtlas ID PDP2
HGNC ID HGNC:30263
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]