You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08303
Secondary Accession Numbers
  • 14015
Name ADP-ribosylation factor 5
Synonyms Not Available
Gene Name ARF5
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Golgi apparatus
Gene Properties
Chromosome Location Chromosome:7
Locus 7q31.3
SNPs ARF5
Gene Sequence
>543 bp
ATGGGCCTCACCGTGTCCGCGCTCTTTTCGCGGATCTTCGGGAAGAAGCAGATGCGGATT
CTCATGGTTGGCTTGGATGCGGCTGGCAAGACCACAATCCTGTACAAACTGAAGTTGGGG
GAGATTGTCACCACCATCCCAACCATAGGCTTCAATGTAGAAACAGTGGAATATAAGAAC
ATCTGTTTCACAGTCTGGGACGTGGGAGGCCAGGACAAGATTCGGCCTCTGTGGCGGCAC
TACTTCCAGAACACTCAGGGCCTCATCTTTGTGGTGGACAGTAATGACCGGGAGCGGGTC
CAAGAATCTGCTGATGAACTCCAGAAGATGCTGCAGGAGGACGAGCTGCGGGATGCAGTG
CTGCTGGTATTTGCCAACAAGCAGGACATGCCCAACGCCATGCCCGTGAGCGAGCTGACT
GACAAGCTGGGGCTACAGCACTTACGCAGCCGCACGTGGTATGTCCAGGCCACCTGTGCC
ACCCAAGGCACAGGTCTGTACGATGGTCTGGACTGGCTGTCCCACGAGCTGTCAAAGCGC
TAA
Protein Properties
Number of Residues 180
Molecular Weight 20529.5
Theoretical pI 6.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ADP-ribosylation factor 5
MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAV
LLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
GenBank ID Protein 20147661
UniProtKB/Swiss-Prot ID P84085
UniProtKB/Swiss-Prot Entry Name ARF5_HUMAN
PDB IDs
GenBank Gene ID AF493884
GeneCard ID ARF5
GenAtlas ID ARF5
HGNC ID HGNC:658
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Haynes LP, Sherwood MW, Dolman NJ, Burgoyne RD: Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta. Traffic. 2007 Aug;8(8):1080-92. Epub 2007 Jun 6. [PubMed:17555535 ]
  3. Andreev J, Simon JP, Sabatini DD, Kam J, Plowman G, Randazzo PA, Schlessinger J: Identification of a new Pyk2 target protein with Arf-GAP activity. Mol Cell Biol. 1999 Mar;19(3):2338-50. [PubMed:10022920 ]
  4. Tsuchiya M, Price SR, Tsai SC, Moss J, Vaughan M: Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells. J Biol Chem. 1991 Feb 15;266(5):2772-7. [PubMed:1993656 ]
  5. McGuire RE, Daiger SP, Green ED: Localization and characterization of the human ADP-ribosylation factor 5 (ARF5) gene. Genomics. 1997 May 1;41(3):481-4. [PubMed:9169151 ]
  6. Shiba T, Koga H, Shin HW, Kawasaki M, Kato R, Nakayama K, Wakatsuki S: Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15416-21. Epub 2006 Oct 9. [PubMed:17030804 ]