Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08306
Secondary Accession Numbers
  • 14018
Name ADP-ribosylation factor GTPase-activating protein 2
Synonyms
  1. ARF GAP 2
  2. GTPase-activating protein ZNF289
  3. Zinc finger protein 289
Gene Name ARFGAP2
Protein Type Unknown
Biological Properties
General Function Involved in ARF GTPase activator activity
Specific Function GTPase-activating protein (GAP) for ADP ribosylation factor 1 (ARF1). Implicated in coatomer-mediated protein transport between the Golgi complex and the endoplasmic reticulum. Hydrolysis of ARF1-bound GTP may lead to dissociation of coatomer from Golgi-derived membranes to allow fusion with target membranes
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
zinc ion binding
enzyme regulator activity
arf gtpase activator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of cellular metabolic process
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
regulation of nucleotide metabolic process
regulation of nucleotide catabolic process
regulation of purine nucleotide catabolic process
regulation of gtp catabolic process
regulation of gtpase activity
regulation of ras gtpase activity
regulation of arf gtpase activity
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Cytoplasmic side
Gene Properties
Chromosome Location Chromosome:1
Locus 11p11.2-p11.12
SNPs ARFGAP2
Gene Sequence
>1566 bp
ATGGCGGCGGAGCCGAACAAGACCGAAATCCAGACTCTTTTTAAGAGGCTTCGCGCAGTT
CCAACCAACAAGGCCTGTTTCGACTGCGGCGCCAAGAATCCGAGTTGGGCCAGCATCACG
TACGGTGTTTTCTTGTGCATTGACTGTTCCGGGGTGCACCGCTCCCTGGGCGTCCATCTG
AGCTTCATCAGGTCCACAGAGTTGGATTCCAACTGGAACTGGTTCCAGCTGAGGTGTATG
CAGGTCGGCGGGAATGCCAATGCGACGGCTTTTTTTCGCCAACATGGATGCACAGCCAAT
GATGCCAACACCAAATATAATAGCCGAGCTGCCCAGATGTACCGGGAGAAGATCCGGCAG
CTGGGGAGTGCGGCCCTGGCTAGGCATGGCACTGATCTTTGGATAGACAACATGAGTAGT
GCCGTTCCTAATCACTCCCCAGAGAAGAAGGACTCTGATTTCTTCACAGAACACACTCAA
CCCCCTGCCTGGGATGCGCCAGCCACTGAGCCTTCAGGGACCCAGCAGCCAGCCCCGTCT
ACAGAGAGCAGTGGCCTGGCACAGCCGGAGCATGGCCCCAACACAGACCTGCTTGGCACC
TCACCCAAAGCCTCACTGGAACTGAAAAGCTCCATCATTGGCAAGAAGAAGCCAGCAGCA
GCTAAGAAAGGGCTGGGTGCCAAGAAAGGCCTAGGGGCCCAGAAGGTGAGCAGCCAGAGC
TTCAGTGAGATTGAGCGGCAGGCTCAGGTGGCAGAGAAGCTCCGTGAGCAGCAGGCAGCC
GATGCCAAGAAGCAGGCGGAGGAGTCCATGGTCGCCTCCATGCGTCTGGCCTACCAGGAG
CTCCAGATTGATCGTAAGAAAGAGGAAAAGAAGCTACAGAATCTGGAAGGGAAGAAGCGA
GAGCAGGCAGAAAGGTTGGGCATGGGCTTGGTATCCCGAAGCTCTGTCTCCCACTCCGTG
CTGTCTGAGATGCAGGTGATTGAGCAGGAAACCCCAGTGAGTGCAAAATCCTCTCGCTCG
CAGCTGGACTTGTTTGACGATGTTGGTACTTTCGCCTCTGGACCCCCAAAGTACAAGGAC
AATCCCTTTTCCTTAGGGGAAAGCTTTGGCTCCCGCTGGGATACAGATGCTGCCTGGGGT
ATGGACAGGGTAGAGGAGAAGGAGCCAGAAGTGACCATCTCAAGCATCCGGCCTATTTCA
GAAAGAGCCACAAACCGGAGGGAAGTGGAGAGCCGGAGCTCAGGCCTCGAGTCTAGTGAG
GCGCGTCAGAAATTCGCAGGAGCCAAAGCCATCTCATCTGACATGTTCTTTGGGCGGGAG
GTGGATGCGGAGTATGAGGCCAGGTCTCGGCTGCAGCAGCTCTCAGGCAGCAGTGCCATC
AGCTCTTCAGACCTCTTTGGGGACATGGATGGAGCTCACGGAGCAGGAAGTGTATCTCTG
GGGAACGTGCTGCCTACAGCGGACATTGCCCAGTTTAAGCAGGGTGTCAAGTCTGTGGCT
GGGAAAATGGCTGTGCTGGCCAATGGTGTGATGAATTCCTTGCAGGATCGCTACGGTTCC
TACTGA
Protein Properties
Number of Residues 521
Molecular Weight 56719.9
Theoretical pI 8.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>ADP-ribosylation factor GTPase-activating protein 2
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
GenBank ID Protein 31543983
UniProtKB/Swiss-Prot ID Q8N6H7
UniProtKB/Swiss-Prot Entry Name ARFG2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032389.3
GeneCard ID ARFGAP2
GenAtlas ID ARFGAP2
HGNC ID HGNC:13504
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  9. Ohira M, Morohashi A, Nakamura Y, Isogai E, Furuya K, Hamano S, Machida T, Aoyama M, Fukumura M, Miyazaki K, Suzuki Y, Sugano S, Hirato J, Nakagawara A: Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma. Cancer Lett. 2003 Jul 18;197(1-2):63-8. [PubMed:12880961 ]
  10. Watson PJ, Frigerio G, Collins BM, Duden R, Owen DJ: Gamma-COP appendage domain - structure and function. Traffic. 2004 Feb;5(2):79-88. [PubMed:14690497 ]
  11. Frigerio G, Grimsey N, Dale M, Majoul I, Duden R: Two human ARFGAPs associated with COP-I-coated vesicles. Traffic. 2007 Nov;8(11):1644-55. Epub 2007 Sep 29. [PubMed:17760859 ]