You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08309
Secondary Accession Numbers
  • 14021
Name Arfaptin-2
Synonyms
  1. ADP-ribosylation factor-interacting protein 2
  2. Partner of RAC1
  3. Protein POR1
Gene Name ARFIP2
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Putative target protein of ADP-ribosylation factor. Involved in membrane ruffling
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15
SNPs ARFIP2
Gene Sequence
>1026 bp
ATGACGGACGGGATCCTAGGGAAGGCAGCCACAATGGAGATCCCTATCCACGGGAACGGC
GAAGCCAGGCAGCTTCCTGAAGATGATGGGCTGGAGCAGGACCTCCAGCAGGTGATGGTG
TCAGGACCCAACCTCAATGAAACCAGCATTGTGTCTGGTGGCTATGGGGGCTCTGGTGAT
GGACTCATCCCCACAGGGTCTGGCCGCCATCCATCTCACAGCACCACTCCTTCTGGCCCT
GGAGATGAGGTGGCTCGGGGCATTGCTGGAGAAAAGTTTGACATCGTCAAGAAATGGGGC
ATCAACACCTATAAGTGCACAAAGCAACTGTTATCAGAACGATTTGGTCGAGGCTCACGG
ACTGTGGACCTGGAGCTAGAGCTGCAGATTGAGTTGCTGCGTGAGACGAAGCGCAAGTAT
GAGAGTGTCCTGCAGCTGGGCCGGGCACTGACAGCCCACCTCTACAGCCTGCTGCAGACC
CAGCATGCACTGGGTGATGCCTTTGCTGACCTCAGCCAGAAGTCCCCAGAGCTTCAGGAG
GAATTTGGCTACAATGCAGAGACACAGAAACTACTATGCAAGAATGGGGAAACGCTGCTA
GGAGCCGTGAACTTCTTTGTCTCTAGCATCAACACATTGGTCACCAAGACCATGGAAGAC
ACGCTCATGACTGTGAAACAGTATGAGGCTGCCAGGCTGGAATATGATGCCTACCGAACA
GACTTAGAGGAGCTGAGTCTAGGCCCCCGGGATGCAGGGACACGTGGTCGACTTGAGAGT
GCCCAGGCCACTTTCCAGGCCCATCGGGACAAGTATGAGAAGCTGCGGGGAGATGTGGCC
ATCAAGCTCAAGTTCCTGGAAGAAAACAAGATCAAGGTGATGCACAAGCAGCTGCTGCTC
TTCCACAATGCTGTGTCCGCCTACTTTGCTGGGAACCAGAAACAGCTGGAGCAGACCCTG
CAGCAGTTCAACATCAAGCTGCGGCCTCCAGGAGCTGAGAAACCCTCCTGGCTAGAGGAG
CAGTGA
Protein Properties
Number of Residues 341
Molecular Weight 37855.5
Theoretical pI 5.91
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Arfaptin-2
MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD
GLIPTGSGRHPSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR
TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE
EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT
DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL
FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
GenBank ID Protein 12653247
UniProtKB/Swiss-Prot ID P53365
UniProtKB/Swiss-Prot Entry Name ARFP2_HUMAN
PDB IDs
GenBank Gene ID BC000392
GeneCard ID ARFIP2
GenAtlas ID ARFIP2
HGNC ID HGNC:17160
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Tarricone C, Xiao B, Justin N, Walker PA, Rittinger K, Gamblin SJ, Smerdon SJ: The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways. Nature. 2001 May 10;411(6834):215-9. [PubMed:11346801 ]
  3. Kanoh H, Williger BT, Exton JH: Arfaptin 1, a putative cytosolic target protein of ADP-ribosylation factor, is recruited to Golgi membranes. J Biol Chem. 1997 Feb 28;272(9):5421-9. [PubMed:9038142 ]
  4. Van Aelst L, Joneson T, Bar-Sagi D: Identification of a novel Rac1-interacting protein involved in membrane ruffling. EMBO J. 1996 Aug 1;15(15):3778-86. [PubMed:8670882 ]