You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08318
Secondary Accession Numbers
  • 14030
Name Brefeldin A-inhibited guanine nucleotide-exchange protein 2
Synonyms
  1. Brefeldin A-inhibited GEP 2
Gene Name ARFGEF2
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
binding
enzyme regulator activity
arf guanyl-nucleotide exchange factor activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
biological regulation
regulation of biological process
regulation of arf protein signal transduction
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 20q13.13
SNPs ARFGEF2
Gene Sequence
>5358 bp
ATGCAGGAGAGCCAGACCAAGAGCATGTTCGTGTCCCGGGCCCTGGAGAAGATCCTAGCC
GACAAGGAGGTGAAGCGGCCCCAGCACTCCCAGCTGCGCAGGGCCTGCCAGGTGGCGCTC
GATGAAATTAAAGCAGAAATAGAAAAGCAGAGGCTTGGCACTGCTGCACCACCAAAGGCA
AACTTCATTGAAGCTGACAAGTATTTTCTTCCATTCGAGCTAGCTTGCCAGTCCAAGTCC
CCAAGGGTAGTCAGCACATCCCTTGACTGCTTGCAGAAACTCATCGCATACGGGCACATC
ACTGGCAACGCCCCTGACAGTGGAGCCCCTGGGAAGCGGCTGATCGACAGAATTGTTGAA
ACCATTTGCAGTTGTTTTCAGGGCCCTCAGACTGATGAAGGGGTTCAGTTACAAATAATT
AAGGCTCTTCTGACTGCAGTGACTTCCCCACACATTGAAATTCATGAGGGTACTATCCTG
CAGACAGTGAGAACATGTTACAATATCTATTTGGCCAGCAAAAATCTCATCAATCAAACC
ACTGCCAAGGCTACCCTTACTCAGATGCTGAACGTCATTTTCACCCGCATGGAAAACCAA
GTGTTGCAGGAGGCCAGAAGACTGGAAAAACCAATCCAGTCAAAACCCCAGTCCCCTGTG
ATCCAAGCTGCAGCAGTATCCCCAAAGTTCGTTCGTTTGAAGCACAGTCAGGCACAAAGC
AAACCAACAACTCCCGAAAAAACAGATTTAACCAACGGTGAACATGCCAGGAGTGATTCT
GGAAAAGTAAGCACAGAAAATGGAGACGCACCCAGAGAAAGAGGCTCATCACTGTCAGGG
ACTGATGACGGAGCCCAGGAGGTGGTGAAGGACATCTTGGAAGATGTAGTCACATCTGCC
ATTAAAGAAGCAGCGGAAAAGCATGGTCTGACAGAACCTGAGAGAGTTCTAGGTGAACTG
GAGTGCCAGGAATGTGCTATTCCCCCAGGAGTTGATGAAAACTCACAGACCAACGGGATA
GCCGATGACAGGCAGTCCTTGTCGTCAGCAGATAATCTGGAATCGGATGCACAAGGACAT
CAAGTGGCTGCCAGGTTCTCCCACGTTCTGCAGAAGGATGCCTTCCTTGTGTTCCGCTCC
CTGTGCAAGCTGTCCATGAAACCCCTTGGTGAAGGCCCTCCAGACCCAAAATCCCATGAG
CTGCGTTCCAAGGTGGTTTCCCTGCAGCTGCTCCTCTCTGTGTTGCAAAATGCTGGCCCC
GTATTCAGGACTCACGAGATGTTCATCAATGCAATCAAGCAATATCTCTGTGTGGCCTTG
TCCAAAAACGGCGTCTCTTCAGTGCCTGATGTCTTTGAGCTCTCTCTTGCCATTTTTCTT
ACTCTTCTTTCAAACTTTAAAATGCACTTGAAAATGCAGATAGAGGTCTTTTTCAAAGAG
ATTTTCCTGAACATTTTAGAAACATCAACAAGTTCTTTTGAGCACAGGTGGATGGTCATT
CAGACTCTGACGAGGATCTGTGCAGATGCCCAGTGTGTTGTGGATATTTATGTCAACTAC
GACTGTGATTTAAATGCTGCTAACATTTTTGAGCGCCTTGTAAATGATTTATCCAAAATT
GCTCAGGGAAGAAGTGGACATGAGCTGGGAATGACACCTCTGCAGGAGCTCAGCCTGAGG
AAGAAAGGCCTGGAGTGCCTCGTGTCCATTCTCAAGTGCATGGTGGAGTGGAGCAAAGAC
CTGTATGTGAATCCCAACCACCAGACCAGCCTCGGTCAGGAGAGGCTCACGGATCAGGAA
ATAGGGGATGGGAAAGGCCTTGACATGGCAAGACGGTGTAGTGTGACGTCCATGGAGTCC
ACAGTGTCCTCGGGGACCCAGACAACTGTTCAGGATGACCCTGAGCAATTTGAGGTCATC
AAGCAACAAAAAGAAATCATTGAACACGGCATCGAGCTGTTCAACAAGAAACCCAAGAGG
GGGATCCAGTTTCTCCAGGAGCAGGGCATGCTGGGAACGTCAGTTGAAGACATAGCCCAA
TTCCTGCACCAGGAGGAGCGCCTGGATTCCACCCAAGTAGGCGATTTTCTGGGAGATAGC
GCAAGGTTCAACAAGGAGGTGATGTATGCCTACGTGGACCAACTTGACTTCTGTGAAAAA
GAATTTGTCTCAGCCCTGCGGACATTCCTAGAAGGTTTCCGCCTACCTGGAGAAGCCCAA
AAGATTGACCGATTAATGGAGAAGTTTGCCGCAAGATACATAGAATGCAACCAAGGGCAA
ACTCTGTTTGCTAGTGCTGACACTGCTTATGTCCTAGCGTATTCAATTATTATGCTGACT
ACAGACTTGCACAGTCCTCAGGTAAAAAATAAAATGACGAAAGAGCAGTATATTAAAATG
AATCGGGGTATCAATGATAGTAAAGATCTGCCAGAAGAGTATCTCTCAAGCATCTATGAA
GAGATAGAAGGCAAGAAAATTGCAATGAAAGAAACAAAAGAGCTAACGATTGCAACCAAA
TCTACTAAGCAGAATGTAGCTAGTGAAAAGCAGCGGCGGCTGCTGTACAACTTAGAGATG
GAGCAAATGGCTAAAACAGCCAAAGCTCTGATGGAGGCTGTGAGCCATGCCAAAGCCCCG
TTTACCAGTGCCACTCACCTGGACCATGTCCGGCCAATGTTCAAACTGGTGTGGACGCCA
CTATTGGCAGCCTACAGCATCGGACTCCAGAACTGTGATGACACTGAAGTGGCCTCCTTG
TGTTTGGAAGGCATCCGATGTGCAATCCGAATCGCCTGCATCTTTGGAATGCAGCTGGAA
CGAGATGCCTATGTTCAGGCTCTTGCTCGCTTCTCCCTACTCACAGCCAGCTCCAGCATC
ACAAAAATGAAGCAGAAAAACATCGACACCATTAAGACGCTTATCACAGTGGCTCACACC
GATGGCAACTACCTTGGGAATTCCTGGCATGAGATCTTGAAATGCATCAGCCAGCTGGAG
CTCGCTCAGCTGATAGGAACCGGTGTGAAGACGCGCTACCTGTCTGGATCTGGGCGTGAA
AGAGAAGGGAGCCTGAAGGGCCACACATTGGCAGGAGAAGAGTTCATGGGCCTTGGCCTC
GGTAATTTGGTGAGTGGCGGAGTGAATAAAAGACAGATGGCCAGCTTCCAAGAATCGGTT
GGTGAGACCAGCTCGCAGAGTGTGGTTGTAGCTGTGGACAGGATTTTTACTGGGTCTACC
AGACTGGATGGAAATGCAATAGTTGACTTTGTCCGCTGGCTGTGTGCTGTGTCCATGGAT
GAACTGGCTTCCCCCCACCATCCTCGCATGTTCAGCTTGCAGAAGATTGTGGAGATATCA
TACTACAACATGAATCGGATCCGACTACAGTGGTCTCGAATATGGCATGTGATTGGAGAT
CACTTCAATAAGGTTGGCTGCAACCCTAATGAAGATGTGGCTATCTTTGCTGTTGACTCA
TTAAGGCAACTCTCCATGAAGTTTCTTGAGAAGGGTGAATTAGCCAACTTCCGTTTCCAG
AAAGATTTTCTGAGGCCCTTTGAGCATATTATGAAGAAAAACAGGTCTCCCACCATCCGG
GACATGGCGATCCGCTGCATTGCCCAGATGGTGAACTCCCAGGCGGCCAACATCCGCTCA
GGCTGGAAGAACATCTTTGCCGTGTTCCACCAGGCAGCCTCTGATCATGATGGGAACATT
GTGGAGCTGGCCTTCCAGACCACTTGCCACATTGTCACAACTATTTTCCAGCACCATTTT
CCTGCAGCCATCGATTCCTTTCAGGATGCTGTGAAGTGCTTATCAGAGTTCGCCTGCAAC
GCCGCTTTCCCTGACACGAGCATGGAAGCGATTCGGCTCATCCGCTTCTGTGGCAAATAC
GTCTCTGAGAGGCCTCGGGTGCTACAAGAATACACAAGTGATGACATGAATGTAGCTCCT
GGTGACAGAGTCTGGGTCCGAGGCTGGTTCCCCATCTTATTCGAACTCTCCTGCATCATT
AATAGATGCAAGTTAGATGTACGAACAAGGGGACTCACAGTCATGTTTGAGATCATGAAG
AGCTATGGCCACACCTTTGAAAAGCACTGGTGGCAGGACCTGTTCAGAATCGTGTTTCGG
ATTTTTGACAATATGAAACTCCCTGAGCAACTGTCAGAGAAATCTGAGTGGATGACAACA
ACCTGCAATCACGCACTTTATGCTATTTGTGATGTTTTTACCCAGTTTTATGAAGCTTTG
AATGAAGTTCTTCTTTCTGATGTATTTGCACAATTGCAGTGGTGTGTCAAACAAGATAAT
GAACAGTTGGCGCGATCAGGTACAAATTGCTTAGAAAACTTAGTAATATCCAATGGAGAG
AAATTCAGTCCTGAAGTCTGGGATGAAACCTGCAACTGTATGTTGGATATTTTCAAAACA
ACCATCCCACATGTTTTGCTGACATGGAGACCTGTAGGAATGGAGGAAGATTCATCAGAA
AAGCATTTGGATGTGGATCTGGACCGCCAGTCTTTAAGCAGCATAGATAAAAATCCCTCT
GAGAGGGGACAGAGCCAGCTCTCTAACCCAACAGATGACAGCTGGAAGGGTAGACCATAC
GCAAATCAGAAACTGTTTGCCAGCCTCCTCATCAAGTGTGTGGTCCAGTTGGAATTGATA
CAGACCATTGACAACATTGTGTTCTACCCTGCGACGAGCAAAAAGGAGGATGCAGAGCAC
ATGGTTGCCGCCCAGCAAGACACGCTGGATGCAGATATCCACATAGAGACGGAGGATCAG
GGCATGTATAAGTACATGTCTTCCCAGCACCTCTTCAAGCTGTTGGACTGTTTGCAGGAA
TCCCATTCATTCTCAAAGGCCTTCAACTCCAATTACGAGCAGCGGACTGTCCTGTGGCGA
GCAGGTTTTAAGGGCAAGTCTAAACCCAATCTTCTAAAACAAGAAACCAGCAGCCTGGCC
TGTTGTTTGAGGATCCTGTTTCGAATGTATGTTGATGAGAACCGCAGGGATTCCTGGGAA
GAAATACAGCAGAGACTTTTAACTGTTTGCAGTGAAGCTCTTGCCTATTTCATCACTGTG
AATTCTGAGAGCCATCGGGAGGCCTGGACAAGTCTCTTGTTGTTACTTCTAACTAAAACC
CTCAAAATAAATGATGAAAAGTTCAAAGCACATGCTTCAATGTACTACCCCTACTTGTGT
GAAATTATGCAGTTTGACCTGATCCCTGAGCTCCGAGCAGTTCTGCGGAAGTTCTTCCTA
CGGATAAGTGTTGTGTATAAGATATGGATACCAGAAGAGCCATCACAGGTACCAGCAGCA
CTGTCACCAGTGTGGTAG
Protein Properties
Number of Residues 1785
Molecular Weight 202036.5
Theoretical pI 6.28
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Brefeldin A-inhibited guanine nucleotide-exchange protein 2
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGTAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICSCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPIQSKPQSPVIQAAAVSPKFVRLKHSQAQS
KPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSA
IKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGH
QVAARFSHVLQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGP
VFRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKE
IFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKI
AQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSLGQERLTDQE
IGDGKGLDMARRCSVTSMESTVSSGTQTTVQDDPEQFEVIKQQKEIIEHGIELFNKKPKR
GIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEK
EFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLT
TDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMKETKELTIATK
STKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTP
LLAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSI
TEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRE
REGSLKGHTLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGST
RLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGD
HFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIR
DMAIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTCHIVTTIFQHHF
PAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVAP
GDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFR
IFDNMKLPEQLSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDN
EQLARSGTNCLENLVISNGEKFSPEVWDETCNCMLDIFKTTIPHVLLTWRPVGMEEDSSE
KHLDVDLDRQSLSSIDKNPSERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLELI
QTIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLDCLQE
SHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSWE
EIQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASMYYPYLC
EIMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPSQVPAALSPVW
GenBank ID Protein 5052123
UniProtKB/Swiss-Prot ID Q9Y6D5
UniProtKB/Swiss-Prot Entry Name BIG2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF084521
GeneCard ID ARFGEF2
GenAtlas ID ARFGEF2
HGNC ID HGNC:15853
References
General References
  1. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  9. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  10. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  11. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  12. Togawa A, Morinaga N, Ogasawara M, Moss J, Vaughan M: Purification and cloning of a brefeldin A-inhibited guanine nucleotide-exchange protein for ADP-ribosylation factors. J Biol Chem. 1999 Apr 30;274(18):12308-15. [PubMed:10212200 ]
  13. Sheen VL, Ganesh VS, Topcu M, Sebire G, Bodell A, Hill RS, Grant PE, Shugart YY, Imitola J, Khoury SJ, Guerrini R, Walsh CA: Mutations in ARFGEF2 implicate vesicle trafficking in neural progenitor proliferation and migration in the human cerebral cortex. Nat Genet. 2004 Jan;36(1):69-76. Epub 2003 Nov 30. [PubMed:14647276 ]