Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08325
Secondary Accession Numbers
  • 14037
Name CDC42 small effector protein 2
Synonyms
  1. Small effector of CDC42 protein 2
Gene Name CDC42SE2
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. Cytoplasm
  4. cytoskeleton
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs CDC42SE2
Gene Sequence
>255 bp
ATGAGTGAATTCTGGTTGTGTTTCAACTGCTGTATTGCAGAACAGCCTCAGCCTAAAAGG
CGACGGCGGATTGACAGAAGTATGATTGGAGAGCCCACAAACTTTGTGCATACAGCTCAT
GTTGGATCAGGAGACCTGTTCAGTGGAATGAATTCAGTTAGCTCCATTCAGAACCAAATG
CAGTCCAAGGGAGGTTATGGAGGTGGAATGCCTGCCAATGTCCAGATGCAGCTCGTGGAT
ACGAAGGCGGGATAG
Protein Properties
Number of Residues 84
Molecular Weight 9223.5
Theoretical pI 8.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>CDC42 small effector protein 2
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQM
QSKGGYGGGMPANVQMQLVDTKAG
GenBank ID Protein 9453926
UniProtKB/Swiss-Prot ID Q9NRR3
UniProtKB/Swiss-Prot Entry Name C42S2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF189692
GeneCard ID CDC42SE2
GenAtlas ID CDC42SE2
HGNC ID HGNC:18547
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Pirone DM, Fukuhara S, Gutkind JS, Burbelo PD: SPECs, small binding proteins for Cdc42. J Biol Chem. 2000 Jul 28;275(30):22650-6. [PubMed:10816584 ]
  4. Ching KH, Kisailus AE, Burbelo PD: The role of SPECs, small Cdc42-binding proteins, in F-actin accumulation at the immunological synapse. J Biol Chem. 2005 Jun 24;280(25):23660-7. Epub 2005 Apr 19. [PubMed:15840583 ]
  5. Ching KH, Kisailus AE, Burbelo PD: Biochemical characterization of distinct regions of SPEC molecules and their role in phagocytosis. Exp Cell Res. 2007 Jan 1;313(1):10-21. Epub 2006 Sep 20. [PubMed:17045588 ]
  6. Chen X, Wang X, Hossain S, O'Neill FA, Walsh D, Pless L, Chowdari KV, Nimgaonkar VL, Schwab SG, Wildenauer DB, Sullivan PF, van den Oord E, Kendler KS: Haplotypes spanning SPEC2, PDZ-GEF2 and ACSL6 genes are associated with schizophrenia. Hum Mol Genet. 2006 Nov 15;15(22):3329-42. Epub 2006 Oct 9. [PubMed:17030554 ]