You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08327
Secondary Accession Numbers
  • 14039
Name Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
Synonyms
  1. Centaurin-beta-1
  2. Cnt-b1
Gene Name ACAP1
Protein Type Unknown
Biological Properties
General Function Involved in ARF GTPase activator activity
Specific Function GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) required for clathrin-dependent export of proteins from recycling endosomes to trans-Golgi network and cell surface
Pathways Not Available
Reactions Not Available
GO Classification
Function
small gtpase regulator activity
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
enzyme regulator activity
arf gtpase activator activity
phospholipase c activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
lipase activity
phospholipase activity
Process
metabolic process
primary metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
lipid metabolic process
intracellular signaling pathway
signaling
signaling pathway
regulation of cellular metabolic process
regulation of nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
regulation of nucleotide metabolic process
regulation of nucleotide catabolic process
regulation of purine nucleotide catabolic process
regulation of gtp catabolic process
regulation of gtpase activity
regulation of ras gtpase activity
regulation of arf gtpase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 17p13.1
SNPs ACAP1
Gene Sequence
>2223 bp
ATGACGGTCAAGCTGGATTTCGAGGAGTGTCTCAAGGACTCACCCCGTTTCCGAGCCTCT
ATTGAGCTGGTGGAAGCCGAAGTGTCAGAATTGGAGACCCGTCTGGAAAAGCTCCTGAAA
CTGGGCACTGGTCTCCTGGAAAGTGGGCGCCATTACCTTGCTGCCAGCCGCGCCTTCGTT
GTCGGCATTTGTGACCTGGCCCGCCTGGGTCCACCAGAGCCCATGATGGCGGAGTGTCTG
GAAAAATTCACCGTGAGCCTGAACCACAAGCTGGACAGCCATGCGGAGCTTCTAGATGCC
ACCCAACACACACTGCAGCAGCAGATCCAGACCCTGGTCAAGGAAGGTCTGCGGGGTTTC
CGAGAGGCTCGCCGGGATTTCTGGCGGGGGGCTGAGAGCCTGGAGGCTGCCCTGACCCAC
AACGCAGAGGTTCCCAGGCGCCGGGCCCAGGAGGCAGAAGAGGCAGGAGCTGCTTTGAGG
ACGGCTCGAGCTGGGTACCGGGGACGGGCACTGGATTATGCCCTGCAGATCAACGTGATT
GAGGACAAGAGGAAGTTTGACATCATGGAGTTTGTGCTGCGTTTGGTGGAGGCCCAGGCT
ACCCATTTCCAGCAGGGCCATGAGGAGCTGAGCCGGCTGTCCCAGTATCGAAAGGAGCTG
GGCGCCCAGTTGCACCAGCTGGTCTTGAATTCAGCACGAGAGAAGAGGGACATGGAGCAG
AGACACGTGCTGCTGAAACAGAAGGAGCTGGGTGGGGAGGAGCCAGAACCAAGCTTAAGA
GAGGGGCCTGGTGGCCTGGTGATGGAAGGACATCTCTTCAAACGGGCCAGCAACGCATTT
AAGACCTGGAGCAGACGCTGGTTCACCATTCAGAGCAACCAACTGGTTTACCAGAAGAAG
TACAAGGACCCTGTGACTGTGGTGGTGGATGACCTTCGTCTCTGCACAGTGAAACTCTGC
CCTGACTCAGAAAGGCGGTTCTGCTTTGAGGTGGTGTCCACCAGCAAGTCCTGCCTCCTC
CAGGCTGACTCAGAGCGCCTCCTGCAGCTGTGGGTCAGTGCTGTGCAGAGCAGCATTGCT
TCTGCCTTCAGTCAGGCTCGCCTTGATGACAGCCCCCGGGGTCCAGGCCAGGGCTCAGGA
CACCTGGCCATAGGCTCTGCTGCCACCCTGGGCTCTGGTGGAATGGCCAGGGGAAGGGAG
CCTGGGGGAGTCGGGCACGTGGTGGCCCAGGTCCAGAGTGTGGATGGCAATGCCCAGTGC
TGCGACTGCCGGGAGCCAGCCCCGGAGTGGGCCAGCATCAACCTTGGTGTCACCCTCTGC
ATTCAGTGTTCCGGCATCCACAGGAGCCTTGGTGTTCACTTCTCCAAAGTCCGGTCTCTG
ACCCTTGACTCATGGGAGCCAGAACTAGTGAAGCTCATGTGTGAGCTGGGAAATGTCATC
ATCAACCAGATCTATGAGGCCCGCGTGGAGGCCATGGCAGTGAAGAAACCAGGGCCCAGC
TGCTCCCGGCAGGAGAAGGAGGCCTGGATTCACGCTAAATACGTGGAGAAGAAGTTCCTG
ACCAAGCTGCCTGAGATTCGAGGGCGAAGAGGTGGCCGGGGGCGCCCAAGGGGGCAGCCT
CCTGTGCCCCCAAAGCCTTCCATCAGGCCCCGGCCAGGGAGCTTGAGATCCAAGCCAGAG
CCCCCCTCTGAGGACCTGGGAAGCCTGCACCCTGGGGCCCTACTGTTTCGAGCGTCTGGG
CATCCTCCATCTCTTCCCACCATGGCTGATGCCCTTGCCCATGGAGCTGATGTCAACTGG
GTCAATGGGGGCCAAGATAATGCCACACCGCTGATCCAGGCCACAGCTGCTAATTCTCTT
CTGGCCTGTGAGTTTCTCCTCCAGAACGGGGCGAACGTGAACCAAGCGGACAGTGCGGGC
CGGGGCCCGCTGCACCACGCAACCATTCTTGGCCACACGGGGCTCGCCTGCCTGTTCCTG
AAACGGGGAGCTGATCTGGGGGCTCGAGACTCTGAAGGCAGGGACCCTCTGACCATCGCC
ATGGAAACAGCCAACGCTGACATCGTCACCCTGCTACGACTGGCAAAGATGAGGGAGGCT
GAAGCGGCCCAGGGGCAGGCAGGAGATGAGACGTATCTTGACATCTTCCGCGACTTCTCC
CTCATGGCGTCAGACGACCCGGAGAAGCTGAGCCGTCGCAGTCATGACCTCCACACGCTG
TGA
Protein Properties
Number of Residues 740
Molecular Weight 81535.1
Theoretical pI 7.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFV
VGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVI
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQP
PVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNW
VNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
GenBank ID Protein 17391289
UniProtKB/Swiss-Prot ID Q15027
UniProtKB/Swiss-Prot Entry Name ACAP1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC018543
GeneCard ID ACAP1
GenAtlas ID ACAP1
HGNC ID HGNC:16467
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  5. Zhan X, Desiderio DM: Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry. Anal Biochem. 2006 Jul 15;354(2):279-89. Epub 2006 Jun 5. [PubMed:16777052 ]
  6. Jackson TR, Brown FD, Nie Z, Miura K, Foroni L, Sun J, Hsu VW, Donaldson JG, Randazzo PA: ACAPs are arf6 GTPase-activating proteins that function in the cell periphery. J Cell Biol. 2000 Oct 30;151(3):627-38. [PubMed:11062263 ]
  7. Li J, Ballif BA, Powelka AM, Dai J, Gygi SP, Hsu VW: Phosphorylation of ACAP1 by Akt regulates the stimulation-dependent recycling of integrin beta1 to control cell migration. Dev Cell. 2005 Nov;9(5):663-73. [PubMed:16256741 ]
  8. Shinozaki-Narikawa N, Kodama T, Shibasaki Y: Cooperation of phosphoinositides and BAR domain proteins in endosomal tubulation. Traffic. 2006 Nov;7(11):1539-50. Epub 2006 Sep 30. [PubMed:17010122 ]
  9. Ma Z, Nie Z, Luo R, Casanova JE, Ravichandran KS: Regulation of Arf6 and ACAP1 signaling by the PTB-domain-containing adaptor protein GULP. Curr Biol. 2007 Apr 17;17(8):722-7. Epub 2007 Mar 29. [PubMed:17398097 ]
  10. Li J, Peters PJ, Bai M, Dai J, Bos E, Kirchhausen T, Kandror KV, Hsu VW: An ACAP1-containing clathrin coat complex for endocytic recycling. J Cell Biol. 2007 Jul 30;178(3):453-64. [PubMed:17664335 ]