Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08329
Secondary Accession Numbers
  • 14041
Name Coatomer subunit alpha
Synonyms
  1. Alpha-COP
  2. Alpha-coat protein
  3. HEP-COP
  4. HEPCOP
  5. Proxenin
  6. Xenin
  7. Xenopsin-related peptide
Gene Name COPA
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
endoplasmic reticulum
macromolecular complex
protein complex
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
vesicle coat
copi vesicle coat
Function
ion binding
cation binding
metal ion binding
binding
structural molecule activity
unfolded protein binding
protein binding
calcium ion binding
Process
metabolic process
macromolecule metabolic process
establishment of localization
transport
protein transport
cellular protein metabolic process
protein folding
intracellular protein transport
vesicle-mediated transport
protein metabolic process
Cellular Location
  1. Xenin:Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 1q23-q25
SNPs COPA
Gene Sequence
>3675 bp
ATGTTAACCAAATTCGAGACCAAGAGCGCGCGGGTCAAAGGGCTCAGCTTTCACCCCAAA
AGACCTTGGATCCTGACTAGTTTACATAATGGGGTCATCCAGTTATGGGACTATCGGATG
TGCACTCTCATTGACAAGTTTGATGAACATGATGGTCCAGTGCGAGGCATTGACTTCCAT
AAGCAGCAGCCACTGTTCGTCTCTGGAGGAGATGACTATAAGATTAAGGTTTGGAATTAC
AAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAGATTATATTCGCACCACGTTT
TTTCATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCATCCGAGTGTGG
AACTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCATTATGTGATGTGT
GCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGC
GTTTGGGATATTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGAT
GTGAGAGGAATAACTGGGGTTGATCTATTTGGAACTACAGATGCAGTGGTGAAGCATGTA
CTAGAGGGTCACGATCGTGGAGTAAACTGGGCTGCCTTCCACCCCACTATGCCCCTTATT
GTATCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCATGAATGAATCAAAGGCATGG
GAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTCTTCCACCCTCGC
CAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAG
CGGACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCAC
CCTAACCTTAACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTGTTTAAGCTGGAA
CGGGAACGGCCAGCCTATGCTGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTC
TTACGACAGCTGGATTTCAACAGCTCCAAAGATGTAGCTGTGATGCAGTTGCGGAGTGGT
TCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAGAAAATGCAGTCCTGCTTTGT
ACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCCTAAAGATGCT
GACTCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGG
GTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTGATCAAGAATCTG
AAGAATGAGATCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGC
ACAGGCAATCTCCTGCTTCGAGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAG
CGGACTCTGGCATCTGTGAAGATTTCTAAAGTGAAATACGTTATCTGGTCAGCAGACATG
TCACATGTAGCACTACTAGCCAAACACGCCATTGTGATCTGTAACCGCAAACTGGATGCT
TTATGTAACATTCATGAGAACATTCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTA
TTTATCTATACCACAAGCAACCACATCAAATATGCTGTCACCACTGGGGACCACGGGATC
ATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGGGCAACAATGTATACTGC
CTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAAATTCAAG
CTGGCCCTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTA
GTTGGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCAT
TTTGTCAAGGATGAGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATT
GCTCTGGAAGCAGCCAAAGCACTGGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTG
GCCCTGCTGCAGGGGAACCACCAGATTGTGGAAATGTGCTATCAGCGTACCAAAAACTTT
GACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAAAACTTCGCAAGATGATG
AAGATTGCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATACCTGGGT
GATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTC
ACAGCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCA
GAGAAGGAGACAATCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCT
ATCATGCCATTGGATACCAATTGGCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGC
ACCATTGCCAGCAAAGGGAAGGGAGGAGCACTGGCTGCTGACATTGACATTGACACTGTT
GGTACAGAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATGAAGATGGGTTTGTGGAG
GCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGGTGGCTGG
GATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGT
GGGGCTGAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGG
TGTAATAACTCTCAGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATG
CGGCTCCTTCATGACCAAGTAGGGGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTA
CAGACATACGCCCGAGGCCGCACAACCTATCAGGCTCTGCCCTGCCTACCCTCCATGTAT
GGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATGGTGTACCAGCTGTGGGC
CTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCACAGTTGGC
AAATTTGAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTT
GTGGACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTAC
ATTGTGGGTTTGTCCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAG
CAGAAGCGCATCTGTGAGATGGCAGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCAC
ATGATCCTGGTGCTGCGTACAGCCCTCAATCTGTTCTTCAAGCTCAAGAACTTCAAGACA
GCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGCCTGAGGTGGCCCAACAG
ACCCGAAAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCTCAATTAT
GACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAG
CCAGTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATC
TGCAGGGTCACCACAGTGACAGAGATTGGCAAAGATGTGATTGGTTTAAGGATCAGTCCT
CTGCAGTTTCGCTAA
Protein Properties
Number of Residues 1224
Molecular Weight 138344.6
Theoretical pI 7.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit alpha
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAG
GAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR
GenBank ID Protein 55959859
UniProtKB/Swiss-Prot ID P53621
UniProtKB/Swiss-Prot Entry Name COPA_HUMAN
PDB IDs Not Available
GenBank Gene ID AL445230
GeneCard ID COPA
GenAtlas ID COPA
HGNC ID HGNC:2230
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  8. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  9. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  11. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  12. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  13. Chow VT, Quek HH: HEP-COP, a novel human gene whose product is highly homologous to the alpha-subunit of the yeast coatomer protein complex. Gene. 1996 Mar 9;169(2):223-7. [PubMed:8647451 ]
  14. Feurle GE, Hamscher G, Kusiek R, Meyer HE, Metzger JW: Identification of xenin, a xenopsin-related peptide, in the human gastric mucosa and its effect on exocrine pancreatic secretion. J Biol Chem. 1992 Nov 5;267(31):22305-9. [PubMed:1429581 ]
  15. Chow VT, Quek HH: Alpha coat protein COPA (HEP-COP): presence of an Alu repeat in cDNA and identity of the amino terminus to xenin. Ann Hum Genet. 1997 Jul;61(Pt 4):369-73. [PubMed:9365789 ]
  16. Feurle GE: Xenin--a review. Peptides. 1998;19(3):609-15. [PubMed:9533652 ]