Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08332
Secondary Accession Numbers
  • 14044
Name Coatomer subunit delta
Synonyms
  1. Archain
  2. Delta-COP
  3. Delta-coat protein
Gene Name ARCN1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
ap-type membrane coat adaptor complex
clathrin adaptor complex
Function
binding
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Cytoplasmic vesicle
  6. Cytoplasmic side
  7. Cytoplasmic side
  8. COPI-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q23.3
SNPs ARCN1
Gene Sequence
>1536 bp
ATGGTGCTGTTGGCAGCAGCGGTCTGCACAAAAGCAGGAAAGGCTATTGTTTCTCGACAG
TTTGTGGAAATGACCCGAACTCGGATTGAGGGCTTATTAGCAGCTTTTCCAAAGCTCATG
AACACTGGAAAACAACATACGTTTGTTGAAACAGAGAGTGTAAGATATGTCTACCAGCCT
ATGGAGAAACTGTATATGGTACTGATCACTACCAAAAACAGCAACATTTTAGAAGATTTG
GAGACCCTAAGGCTCTTCTCAAGAGTGATCCCTGAATATTGCCGAGCCTTAGAAGAGAAT
GAAATATCTGAGCACTGTTTTGATTTGATTTTTGCTTTTGATGAAATTGTCGCACTGGGA
TACCGGGAGAATGTTAACTTGGCACAGATCAGAACCTTCACAGAAATGGATTCTCATGAG
GAGAAGGTGTTCAGAGCCGTCAGAGAGACTCAAGAACGTGAAGCTAAGGCTGAGATGCGT
CGTAAAGCAAAGGAATTACAACAGGCCCGAAGAGATGCAGAGAGACAGGGCAAAAAAGCA
CCAGGATTTGGCGGATTTGGCAGCTCTGCAGTATCTGGAGGCAGCACAGCTGCCATGATC
ACAGAGACCATCATTGAAACTGATAAACCAAAAGTGGCACCTGCACCAGCCAGGCCTTCA
GGCCCCAGCAAGGCTTTAAAACTTGGAGCCAAAGGAAAGGAAGTAGATAACTTTGTGGAC
AAATTAAAATCTGAAGGTGAAACCATCATGTCCTCTAGTATGGGCAAGCGTACTTCTGAA
GCAACCAAAATGCATGCTCCACCCATTAATATGGAAAGTGTACATATGAAGATTGAAGAA
AAGATAACATTAACCTGTGGACGAGACGGAGGATTACAGAATATGGAGTTGCATGGCATG
ATCATGCTTAGGATCTCAGATGACAAGTATGGCCGAATTCGTCTTCATGTGGAAAATGAA
GATAAGAAAGGGGTGCAGCTACAGACCCATCCAAATGTGGATAAAAAACTTTTCACTGCA
GAGTCTCTAATTGGCCTGAAGAATCCAGAGAAGTCATTTCCAGTCAACAGTGACGTAGGG
GTGCTAAAGTGGAGACTACAAACCACAGAGGAATCTTTTATTCCACTGACAATTAATTGC
TGGCCCTCGGAGAGTGGAAATGGCTGTGATGTCAACATAGAATATGAGCTACAAGAAGAT
AATTTAGAACTGAATGATGTGGTTATCACCATCCCACTCCCGTCTGGTGTCGGCGCGCCT
GTTATCGGTGAGATCGATGGGGAGTATCGACATGACAGTCGACGAAATACCCTGGAGTGG
TGCCTGCCTGTGATTGATGCCAAAAATAAGAGTGGCAGCCTGGAGTTTAGCATTGCTGGG
CAGCCCAATGACTTCTTCCCTGTTCAAGTTTCCTTTGTCTCCAAGAAAAATTACTGTAAC
ATACAGGTTACCAAAGTGACCCAGGTAGATGGAAACAGCCCCGTCAGGTTTTCCACAGAG
ACCACTTTCCTAGTGGATAAGTATGAAATTCTGTAA
Protein Properties
Number of Residues 511
Molecular Weight 57209.9
Theoretical pI 6.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit delta
MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQP
MEKLYMVLITTKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALG
YRENVNLAQIRTFTEMDSHEEKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKA
PGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVD
KLKSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGM
IMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVG
VLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCN
IQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
GenBank ID Protein 62739405
UniProtKB/Swiss-Prot ID P48444
UniProtKB/Swiss-Prot Entry Name COPD_HUMAN
PDB IDs Not Available
GenBank Gene ID BC093636
GeneCard ID ARCN1
GenAtlas ID ARCN1
HGNC ID HGNC:649
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Radice P, Pensotti V, Jones C, Perry H, Pierotti MA, Tunnacliffe A: The human archain gene, ARCN1, has highly conserved homologs in rice and Drosophila. Genomics. 1995 Mar 1;26(1):101-6. [PubMed:7782067 ]