You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08335
Secondary Accession Numbers
  • 14047
Name Coatomer subunit gamma
Synonyms
  1. Gamma-COP
  2. Gamma-coat protein
Gene Name COPG
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non- clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
membrane coat
macromolecular complex
protein complex
organelle
vesicle coat
copi vesicle coat
golgi-associated vesicle
vesicle
Function
binding
structural molecule activity
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Cytoplasmic vesicle
  6. Cytoplasmic side
  7. Cytoplasmic side
  8. COPI-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21.3
SNPs COPG
Gene Sequence
>2625 bp
ATGTTGAAGAAATTCGACAAGAAGGATGAGGAGTCAGGTGGAGGCTCCAACCCATTCCAG
CACCTTGAGAAGAGTGCGGTACTCCAGGAGGCCCGTGTATTTAATGAAACTCCCATCAAC
CCTCGGAAATGTGCCCACATCCTCACCAAGATTCTTTATCTCATAAACCAGGGGGAGCAC
CTGGGGACCACGGAAGCGACCGAGGCCTTCTTTGCCATGACCAAGCTCTTTCAGTCCAAT
GACCCCACACTCCGTCGGATGTGCTACTTGACCATCAAGGAGATGTCTTGCATTGCAGAG
GATGTCATCATTGTCACCAGCAGCCTAACAAAAGACATGACTGGGAAAGAAGACAACTAC
CGGGGCCCGGCCGTGCGAGCCCTCTGCCAGATCACTGATAGCACCATGCTGCAGGCTATT
GAGCGCTACATGAAACAAGCCATTGTGGACAAGGTGCCCAGTGTCTCCAGCTCTGCCCTC
GTGTCTTCCTTGCACCTGCTGAAGTGCAGCTTTGACGTGGTCAAGCGCTGGGTGAATGAG
GCTCAGGAGGCAGCATCCAGTGATAACATCATGGTCCAGTACCACGCACTAGGGCTCCTG
TACCATGTGCGTAAGAATGACCGCCTAGCCGTCAATAAGATGATCAGCAAGGTCACACGG
CATGGCCTTAAGTCTCCCTTTGCCTACTGCATGATGATCCGGGTGGCCAGCAAGCAGCTG
GAAGAGGAGGATGGCAGCCGTGACAGCCCACTGTTTGACTTCATCGAGAGCTGCTTGCGC
AACAAGCACGAGATGGTGGTGTATGAAGCCGCCTCGGCCATTGTCAACCTGCCTGGGTGC
AGCGCCAAGGAGCTGGCCCCAGCTGTCTCAGTGCTCCAGCTCTTCTGCAGCTCCCCCAAG
GCCGCCCTCCGTTACGCCGCCGTCCGCACCCTCAACAAGGTGGCCATGAAGCACCCGTCC
GCTGTGACAGCTTGTAATCTGGATCTGGAGAACCTGGTCACAGATTCAAACCGCAGCATT
GCCACGCTGGCCATCACCACCCTCCTTAAGACGGGCAGCGAGAGCAGCATCGACCGCCTC
ATGAAGCAGATCTCCTCCTTCATGTCAGAAATCTCGGATGAATTCAAGGTGGTGGTTGTC
CAGGCCATCAGTGCCCTGTGTCAGAAATATCCTCGCAAACACGCCGTCCTTATGAACTTC
CTGTTCACCATGCTGCGGGAAGAGGGTGGCTTTGAGTATAAGCGCGCTATCGTGGACTGC
ATCATCAGCATCATTGAAGAGAACTCAGAGAGCAAGGAGACAGGGCTGTCACATCTGTGC
GAGTTCATCGAGGACTGCGAGTTCACAGTGCTGGCCACCCGTATTCTACATCTCCTGGGC
CAGGAGGGGCCCAAGACCACCAATCCCTCAAAGTACATCCGCTTCATCTATAACCGAGTG
GTCTTGGAGCATGAGGAGGTCCGGGCAGGTGCTGTGAGTGCTCTGGCGAAGTTTGGAGCC
CAGAATGAAGAGATGTTACCCAGTATCTTGGTGTTGCTGAAGAGGTGTGTGATGGATGAT
GACAATGAAGTAAGGGACCGAGCCACCTTCTACCTAAATGTCCTGGAGCAGAAGCAGAAG
GCCCTTAATGCAGGCTATATCCTAAATGGTCTGACTGTGTCCATCCCTGGTCTGGAGAGG
GCTCTGCAGCAGTACACTCTAGAACCATCAGAAAAACCTTTTGACCTCAAGTCTGTGCCC
CTGGCCACGGCGCCCATGGCAGAGCAGAGAACAGAAAGTACCCCCATCACAGCAGTCAAA
CAGCCTGAGAAAGTGGCAGCTACCAGGCAGGAGATCTTCCAGGAGCAGTTGGCAGCAGTG
CCAGAGTTCCGCGGTCTTGGGCCCCTCTTCAAGTCCTCGCCTGAGCCCGTGGCCCTCACC
GAGTCAGAGACGGAGTATGTCATCCGCTGCACCAAACACACCTTCACCAACCACATGGTT
TTTCAGTTTGACTGCACAAACACACTCAATGACCAGACCTTGGAGAATGTCACAGTGCAG
ATGGAGCCCACTGAGGCCTATGAGGTGCTCTGTTACGTGCCTGCCCGGAGCCTGCCCTAC
AACCAGCCCGGGACCTGCTACACACTGGTGGCACTGCCCAAAGAAGACCCCACAGCTGTG
GCCTGCACATTCAGCTGCATGATGAAGTTCACTGTCAAGGACTGTGATCCCACCACTGGG
GAGACTGATGACGAAGGCTATGAGGATGAGTATGTGCTGGAAGATCTGGAAGTTACTGTA
GCTGATCACATTCAAAAGGTCATGAAACTGAACTTCGAAGCAGCCTGGGATGAGGTAGGG
GATGAATTTGAGAAGGAGGAAACGTTCACCTTGTCTACCATCAAGACACTTGAAGAGGCT
GTGGGTAATATTGTGAAGTTCTTGGGAATGCACCCTTGTGAGAGGTCAGACAAAGTGCCG
GATAACAAGAACACCCACACGTTGCTCCTGGCTGGTGTGTTCCGGGGTGGTCATGACATC
CTGGTGCGCTCCCGGCTGCTGCTTTTGGACACAGTGACAATGCAGGTGACAGCCAGAAGT
TTGGAGGAGCTGCCAGTAGACATCATCTTGGCATCTGTGGGATAA
Protein Properties
Number of Residues 874
Molecular Weight 97717.3
Theoretical pI 5.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit gamma
MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEH
LGTTEATEAFFAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNY
RGPAVRALCQITDSTMLQAIERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNE
AQEAASSDNIMVQYHALGLLYHVRKNDRLAVNKMISKVTRHGLKSPFAYCMMIRVASKQL
EEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGCSAKELAPAVSVLQLFCSSPK
AALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGSESSIDRL
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVK
QPEKVAATRQEIFQEQLAAVPEFRGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPTAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y678
UniProtKB/Swiss-Prot Entry Name COPG_HUMAN
PDB IDs
GenBank Gene ID AF100756
GeneCard ID COPG
GenAtlas ID COPG
HGNC ID HGNC:2236
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Watson PJ, Frigerio G, Collins BM, Duden R, Owen DJ: Gamma-COP appendage domain - structure and function. Traffic. 2004 Feb;5(2):79-88. [PubMed:14690497 ]