Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08336
Secondary Accession Numbers
  • 14048
Name Coatomer subunit zeta-1
Synonyms
  1. Zeta-1 COP
  2. Zeta-1-coat protein
Gene Name COPZ1
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function The zeta subunit may be involved in regulating the coat assembly and, hence, the rate of biosynthetic protein transport due to its association-dissociation properties with the coatomer complex
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane coat
macromolecular complex
protein complex
Function
binding
protein binding
Process
establishment of localization
transport
protein transport
intracellular protein transport
vesicle-mediated transport
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Cytoplasmic vesicle
  6. Cytoplasmic side
  7. Cytoplasmic side
  8. COPI-coated vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13.2-q13.3
SNPs COPZ1
Gene Sequence
>534 bp
ATGGAGGCGCTGATTTTGGAACCTTCCCTGTATACTGTCAAAGCCATCCTGATTCTGGAC
AATGATGGAGATCGACTTTTTGCCAAGTACTATGACGACACCTACCCCAGTGTCAAGGAG
CAAAAGGCCTTTGAGAAGAACATTTTCAACAAGACCCATCGGACTGACAGTGAAATTGCC
CTCTTGGAAGGCCTGACAGTGGTATACAAAAGCAGTATAGATCTCTATTTCTATGTGATT
GGCAGCTCCTATGAAAATGAGCTGATGCTTATGGCTGTTCTGAACTGTCTCTTCGACTCA
TTGAGCCAGATGCTGAGGAAAAATGTAGAAAAGCGAGCACTGCTGGAGAACATGGAGGGG
CTGTTCTTGGCTGTGGATGAAATTGTAGATGGAGGGGTGATCCTAGAGAGTGATCCCCAG
CAGGTGGTACACCGGGTGGCATTAAGGGGTGAAGATGTCCCCCTTACGGAGCAGACCGTG
TCTCAGGTGCTGCAGTCAGCCAAAGAACAGATCAAGTGGTCACTCCTTCGGTGA
Protein Properties
Number of Residues 177
Molecular Weight 20198.0
Theoretical pI 4.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Coatomer subunit zeta-1
MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIA
LLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEG
LFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR
GenBank ID Protein 11094287
UniProtKB/Swiss-Prot ID P61923
UniProtKB/Swiss-Prot Entry Name COPZ1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB047848
GeneCard ID COPZ1
GenAtlas ID COPZ1
HGNC ID HGNC:2243
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  5. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]
  6. Futatsumori M, Kasai K, Takatsu H, Shin HW, Nakayama K: Identification and characterization of novel isoforms of COP I subunits. J Biochem. 2000 Nov;128(5):793-801. [PubMed:11056392 ]