You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08337
Secondary Accession Numbers
  • 14049
Name Cytoplasmic FMR1-interacting protein 1
Synonyms
  1. Specifically Rac1-associated protein 1
  2. Sra-1
  3. p140sra-1
Gene Name CYFIP1
Protein Type Unknown
Biological Properties
General Function Involved in actin filament binding
Specific Function Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA. Involved in formation of membrane ruffles and lamellipodia protrusions and in axon outgrowth. Binds to F-actin but not to RNA. Regulator of epithelial morphogenesis. May act as an invasion suppressor in cancers
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cytoplasm
  2. perinuclear region
  3. Cell junction
  4. synapse
  5. Cell projection
  6. Cell projection
  7. lamellipodium
  8. synaptosome
  9. ruffle
Gene Properties
Chromosome Location Chromosome:1
Locus 15q11
SNPs CYFIP1
Gene Sequence
>3762 bp
ATGGCGGCCCAGGTGACTCTGGAGGACGCGCTGTCCAACGTGGACCTCCTGGAGGAGCTG
CCCCTGCCCGACCAGCAGCCCTGCATCGAGCCCCCGCCATCCTCGCTGCTCTACCAGCCA
AATTTCAACACTAACTTTGAAGACAGAAATGCATTTGTTACTGGCATCGCAAGATACATT
GAACAAGCCACCGTCCACTCTAGCATGAACGAGATGCTGGAGGAGGGCCAAGAATATGCT
GTCATGCTGTACACCTGGAGGAGCTGCTCCCGGGCCATCCCACAGGTGAAATGTAACGAG
CAGCCTAACAGAGTGGAAATCTACGAGAAAACCGTGGAGGTTCTGGAGCCTGAGGTCACA
AAACTGATGAATTTCATGTACTTCCAGAGAAATGCCATTGAGCGTTTCTGCGGGGAAGTG
AGGCGCCTGTGCCATGCCGAGAGGAGGAAGGACTTCGTGTCAGAAGCCTACCTGATCACA
CTGGGCAAATTCATCAACATGTTCGCTGTGCTGGACGAGCTGAAGAACATGAAGTGCAGT
GTGAAGAACGACCACTCAGCGTACAAGAGGGCCGCTCAGTTTTTACGTAAAATGGCAGAT
CCACAGTCCATCCAGGAATCGCAGAATCTGTCCATGTTCCTGGCCAATCATAACAAGATC
ACACAGTCTCTGCAGCAGCAGCTCGAAGTGATTTCTGGCTACGAAGAGCTCCTGGCAGAT
ATTGTGAATCTGTGTGTGGATTACTACGAGAACAGGATGTATTTGACGCCCAGTGAGAAA
CACATGCTTCTCAAAGTCATGGGATTTGGTCTGTACCTGATGGATGGGAGTGTCAGTAAC
ATCTATAAGTTGGATGCCAAGAAAAGAATAAACTTATCCAAAATCGACAAGTACTTCAAG
CAACTCCAGGTGGTTCCGCTATTTGGGGACATGCAAATAGAACTGGCAAGATATATCAAG
ACCAGCGCCCACTACGAGGAAAATAAATCTCGATGGACGTGCACATCCTCCGGCAGCAGC
CCTCAGTACAACATCTGCGAGCAGATGATCCAGATCCGCGAGGACCACATGCGCTTCATT
TCGGAGCTGGCGCGCTACAGCAACAGCGAGGTGGTCACGGGCTCGGGCCGCCAGGAGGCC
CAGAAGACGGACGCGGAGTACCGCAAGCTCTTCGACCTGGCGCTGCAGGGCCTGCAGCTG
TTGTCGCAGTGGAGCGCGCACGTGATGGAAGTGTATTCCTGGAAGCTTGTGCACCCCACC
GACAAGTACTCCAACAAGGACTGCCCCGACAGCGCTGAAGAGTACGAGCGTGCCACGCGC
TACAACTACACCAGCGAGGAGAAGTTTGCCCTAGTGGAGGTGATCGCCATGATCAAAGGC
CTGCAGGTGCTGATGGGCAGGATGGAGAGCGTGTTCAACCACGCCATCCGGCACACCGTC
TATGCCGCACTGCAGGACTTCTCCCAGGTGACCCTTAGGGAGCCGCTGCGGCAGGCCATC
AAGAAGAAGAAGAACGTCATCCAGAGTGTCCTGCAGGCCATCAGGAAGACCGTGTGTGAC
TGGGAGACGGGGCATGAGCCCTTCAATGACCCAGCCTTGCGGGGCGAGAAGGACCCCAAG
AGCGGCTTCGACATAAAAGTACCACGCCGCGCCGTGGGACCCTCCAGCACTCAGCTTTAC
ATGGTGAGAACCATGCTAGAGTCCCTCATTGCAGACAAAAGTGGTTCCAAGAAAACCTTG
AGAAGTAGCCTTGAGGGGCCCACCATATTGGACATAGAAAAATTTCATCGAGAGTCATTC
TTCTACACTCACTTGATAAATTTCAGTGAAACGCTGCAGCAGTGCTGTGACCTTTCGCAG
CTGTGGTTCCGAGAGTTCTTCCTGGAGCTGACCATGGGCAGGAGGATCCAGTTCCCCATT
GAGATGTCGATGCCCTGGATCCTGACGGACCACATCCTGGAGACCAAGGAGGCATCGATG
ATGGAGTACGTGCTCTACTCCCTGGACCTGTACAATGACAGCGCCCACTACGCGCTCACC
AGGTTCAACAAGCAGTTCCTGTACGACGAAATTGAGGCCGAGGTGAATCTATGTTTTGAC
CAATTTGTTTACAAGCTAGCAGACCAGATATTTGCCTATTATAAGGTTATGGCAGGAAGT
TTGCTTCTTGATAAACGGTTACGATCAGAATGCAAGAATCAGGGAGCCACGATCCACCTC
CCGCCGTCTAACCGCTACGAGACGCTGCTGAAGCAGAGGCATGTGCAGCTCCTCGGCAGA
TCAATAGACCTCAATCGTCTGATCACCCAGCGCGTCTCAGCAGCCATGTATAAGTCCCTA
GAACTGGCGATTGGACGATTTGAAAGTGAAGATTTGACCTCCATAGTTGAGCTGGATGGC
CTGTTGGAAATCAACCGCATGACCCACAAGCTGCTGAGCCGGTACCTGACGCTGGACGGC
TTCGACGCCATGTTCCGGGAGGCCAACCACAACGTGTCAGCGCCCTACGGGAGGATCACC
CTGCACGTCTTCTGGGAGCTCAACTATGACTTCCTGCCCAACTACTGCTACAACGGCTCT
ACCAACCGGTTTGTTCGGACAGTGTTACCATTTTCTCAGGAATTTCAAAGAGATAAGCAG
CCTAATGCACAGCCTCAGTATCTGCATGGATCCAAGGCTTTGAACTTGGCCTACTCCAGC
ATTTACGGCAGCTACCGGAACTTCGTGGGACCTCCACACTTTCAAGTCATCTGCCGGCTT
CTCGGCTACCAGGGTATCGCCGTGGTCATGGAGGAGCTGCTGAAGGTCGTCAAGAGCCTG
CTGCAAGGCACAATCCTGCAGTACGTGAAGACGCTGATGGAGGTGATGCCCAAGATCTGC
CGCCTGCCCCGGCACGAGTACGGCTCTCCTGGTATCCTGGAGTTCTTCCACCACCAGCTG
AAGGACATCGTGGAGTACGCAGAGCTGAAGACGGTGTGCTTCCAGAACCTGCGGGAGGTG
GGGAACGCCATCCTCTTCTGCCTGCTCATCGAGCAGAGCCTGTCTTTAGAAGAAGTGTGT
GACCTGCTGCACGCGGCTCCTTTCCAGAACATCTTGCCGCGAGTCCATGTGAAAGAGGGG
GAGAGACTTGATGCCAAAATGAAAAGACTAGAATCAAAGTACGCCCCGCTGCATCTTGTC
CCACTGATTGAAAGACTGGGGACCCCTCAGCAAATTGCCATCGCAAGAGAGGGGGACCTG
CTGACAAAGGAGCGCCTCTGCTGCGGCCTGTCCATGTTTGAGGTCATCCTGACACGGATC
CGGAGCTTTCTGGATGACCCCATCTGGCGCGGGCCTCTGCCCAGCAATGGGGTCATGCAT
GTGGACGAGTGTGTGGAGTTTCACAGACTGTGGAGTGCCATGCAGTTTGTCTACTGCATT
CCCGTGGGGACACACGAGTTCACAGTCGAGCAGTGCTTTGGTGATGGGCTACACTGGGCT
GGCTGTATGATCATCGTACTTCTTGGGCAGCAGCGGCGTTTTGCTGTGCTGGATTTCTGC
TACCATCTACTTAAAGTCCAGAAACATGATGGCAAAGATGAGATTATTAAAAATGTGCCT
TTGAAGAAGATGGTGGAGAGAATTCGCAAGTTCCAGATTCTCAATGATGAGATCATCACC
ATCCTGGATAAGTACCTGAAGTCAGGCGACGGGGAGGGCACGCCAGTGGAGCATGTGCGC
TGCTTCCAGCCGCCCATCCACCAGTCCCTCGCCAGCAGCTGA
Protein Properties
Number of Residues 1253
Molecular Weight 145181.2
Theoretical pI 6.9
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytoplasmic FMR1-interacting protein 1
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS
GenBank ID Protein 24307969
UniProtKB/Swiss-Prot ID Q7L576
UniProtKB/Swiss-Prot Entry Name CYFP1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014608.2
GeneCard ID CYFIP1
GenAtlas ID CYFIP1
HGNC ID HGNC:13759
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  6. Nomura N, Nagase T, Miyajima N, Sazuka T, Tanaka A, Sato S, Seki N, Kawarabayasi Y, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 1994;1(5):223-9. [PubMed:7584044 ]
  7. Kawano Y, Yoshimura T, Tsuboi D, Kawabata S, Kaneko-Kawano T, Shirataki H, Takenawa T, Kaibuchi K: CRMP-2 is involved in kinesin-1-dependent transport of the Sra-1/WAVE1 complex and axon formation. Mol Cell Biol. 2005 Nov;25(22):9920-35. [PubMed:16260607 ]
  8. Kobayashi K, Kuroda S, Fukata M, Nakamura T, Nagase T, Nomura N, Matsuura Y, Yoshida-Kubomura N, Iwamatsu A, Kaibuchi K: p140Sra-1 (specifically Rac1-associated protein) is a novel specific target for Rac1 small GTPase. J Biol Chem. 1998 Jan 2;273(1):291-5. [PubMed:9417078 ]
  9. Silva JM, Ezhkova E, Silva J, Heart S, Castillo M, Campos Y, Castro V, Bonilla F, Cordon-Cardo C, Muthuswamy SK, Powers S, Fuchs E, Hannon GJ: Cyfip1 is a putative invasion suppressor in epithelial cancers. Cell. 2009 Jun 12;137(6):1047-61. doi: 10.1016/j.cell.2009.04.013. [PubMed:19524508 ]