Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08338
Secondary Accession Numbers
  • 14050
Name Cytohesin-1
Synonyms
  1. PH, SEC7 and coiled-coil domain-containing protein 1
  2. SEC7 homolog B2-1
Gene Name CYTH1
Protein Type Unknown
Biological Properties
General Function Involved in ARF guanyl-nucleotide exchange factor activity
Specific Function Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
enzyme regulator activity
arf guanyl-nucleotide exchange factor activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
biological regulation
regulation of biological process
regulation of arf protein signal transduction
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25
SNPs CYTH1
Gene Sequence
>1197 bp
ATGGAGGAGGACGACAGCTACGTTCCCAGTGACCTGACAGCAGAGGAGCGTCAAGAACTG
GAGAACATCCGACGGAGAAAACAGGAGCTGCTGGCTGACATTCAGAGGCTGAAGGATGAG
ATAGCAGAAGTAGCTAATGAAATTGAAAACCTGGGATCCACAGAGGAAAGGAAAAACATG
CAGAGGAACAAACAGGTAGCCATGGGCAGGAAAAAATTTAATATGGACCCTAAAAAGGGG
ATCCAGTTCTTAATAGAGAACGACCTCCTGAAGAACACTTGTGAAGACATTGCCCAGTTC
TTATATAAAGGCGAAGGGCTCAACAAGACAGCCATCGGCGACTACCTAGGGGAGAGAGAT
GAGTTTAATATCCAGGTTCTTCATGCATTTGTGGAGCTGCATGAGTTCACTGATCTTAAT
CTCGTCCAGGCACTACGGCAGTTCCTGTGGAGCTTCCGGCTACCCGGAGAGGCCCAGAAG
ATCGACCGGATGATGGAGGCGTTTGCCCAGCGATATTGTCAGTGCAATAATGGCGTGTTC
CAGTCCACGGATACTTGTTACGTCCTCTCCTTTGCCATCATCATGTTGAACACCAGTCTG
CACAACCCCAATGTCAAAGATAAGCCCACTGTGGAGAGGTTCATTGCCATGAACCGAGGC
ATCAATGATGGGGGAGACCTGCCGGAGGAGCTCCTCCGGAATCTCTATGAGAGCATAAAA
AATGAACCCTTTAAAATCCCAGAAGACGACGGGAATGACCTCACTCACACTTTCTTCAAT
CCAGACCGAGAAGGCTGGCTATTGAAACTCGGAGGTGGCAGGGTAAAGACTTGGAAGAGA
CGCTGGTTCATTCTGACTGACAACTGCCTTTACTACTTTGAGTATACCACGGATAAGGAG
CCCCGTGGAATCATCCCTTTAGAGAATCTGAGTATCCGGGAAGTGGAGGACTCCAAAAAA
CCAAACTGCTTTGAGCTTTATATCCCCGACAATAAAGACCAAGTTATCAAGGCCTGCAAG
ACCGAGGCTGACGGGCGGGTGGTGGAGGGGAACCACACTGTTTACCGGATCTCAGCTCCG
ACGCCCGAGGAGAAGGAGGAGTGGATTAAGTGCATTAAAGCAGCCATCAGCAGGGACCCT
TTCTACGAAATGCTCGCAGCACGGAAAAAGAAGGTCTCCTCCACGAAGCGACACTGA
Protein Properties
Number of Residues 398
Molecular Weight 46412.3
Theoretical pI 5.21
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytohesin-1
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
GenBank ID Protein 4758964
UniProtKB/Swiss-Prot ID Q15438
UniProtKB/Swiss-Prot Entry Name CYH1_HUMAN
PDB IDs
GenBank Gene ID NM_004762.2
GeneCard ID CYTH1
GenAtlas ID CYTH1
HGNC ID HGNC:9501
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  3. Liu L, Pohajdak B: Cloning and sequencing of a human cDNA from cytolytic NK/T cells with homology to yeast SEC7. Biochim Biophys Acta. 1992 Aug 17;1132(1):75-8. [PubMed:1511013 ]
  4. Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M: Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors. J Biol Chem. 2000 Feb 4;275(5):3221-30. [PubMed:10652308 ]
  5. Vitale N, Pacheco-Rodriguez G, Ferrans VJ, Riemenschneider W, Moss J, Vaughan M: Specific functional interaction of human cytohesin-1 and ADP-ribosylation factor domain protein (ARD1). J Biol Chem. 2000 Jul 14;275(28):21331-9. [PubMed:10748148 ]
  6. Tang P, Cheng TP, Agnello D, Wu CY, Hissong BD, Watford WT, Ahn HJ, Galon J, Moss J, Vaughan M, O'Shea JJ, Gadina M: Cybr, a cytokine-inducible protein that binds cytohesin-1 and regulates its activity. Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2625-9. Epub 2002 Feb 26. [PubMed:11867758 ]
  7. Betz SF, Schnuchel A, Wang H, Olejniczak ET, Meadows RP, Lipsky BP, Harris EA, Staunton DE, Fesik SW: Solution structure of the cytohesin-1 (B2-1) Sec7 domain and its interaction with the GTPase ADP ribosylation factor 1. Proc Natl Acad Sci U S A. 1998 Jul 7;95(14):7909-14. [PubMed:9653114 ]