Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08340
Secondary Accession Numbers
  • 14052
Name Cytohesin-3
Synonyms
  1. ARF nucleotide-binding site opener 3
  2. General receptor of phosphoinositides 1
  3. Grp1
  4. PH, SEC7 and coiled-coil domain-containing protein 3
  5. Protein ARNO3
Gene Name CYTH3
Protein Type Unknown
Biological Properties
General Function Involved in ARF guanyl-nucleotide exchange factor activity
Specific Function Promotes guanine-nucleotide exchange on ARF1. Promotes the activation of ARF through replacement of GDP with GTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
enzyme regulator activity
arf guanyl-nucleotide exchange factor activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
biological regulation
regulation of biological process
regulation of arf protein signal transduction
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22.1
SNPs CYTH3
Gene Sequence
>1200 bp
ATGGATGAAGACGGCGGCGGCGAGGGTGGTGGCGTGCCTGAAGACCTCTCATTAGAAGAG
AGAGAAGAACTTCTAGACATTCGTCGAAGAAAAAAGGAACTTATTGATGACATTGAGAGG
CTGAAATATGAAATTGCAGAGGTGATGACAGAGATCGACAATCTAACTTCCGTAGAGGAG
AGCAAAACGACTCAGAGGAACAAACAGATAGCCATGGGAAGAAAGAAATTCAACATGGAT
CCCAAAAAGGGAATTCAGTTTCTAATAGAAAATGACCTGCTACAGAGTTCCCCAGAAGAC
GTCGCCCAGTTCCTTTATAAAGGAGAAGGCCTAAATAAGACCGTCATTGGGGACTACCTG
GGTGAAAGGGATGAATTTAATATTAAAGTTCTTCAAGCCTTTGTTGAACTCCATGAGTTT
GCTGATCTCAACCTTGTACAAGCCTTAAGGCAGTTCTTATGGAGCTTCAGGCTGCCCGGG
GAGGCGCAGAAGATTGATCGCATGATGGAGGCTTTCGCTTCTCGCTACTGCCTGTGCAAC
CCCGGGGTCTTCCAGTCCACAGACACGTGCTACGTGCTGTCATTCGCCATCATCATGCTC
AACACCAGCCTCCACAACCACAACGTGCGTGACAAGCCCACGGCAGAACGGTTCATCGCC
ATGAACCGCGGCATCAACGAGGGCGGGGACCTCCCTGAGGAGCTGCTGAGGAATTTGTAT
GAGAGCATTAAGAACGAGCCATTTAAGATCCCGGAGGACGACGGGAACGACCTGACCCAC
ACCTTCTTCAACCCCGACCGCGAGGGCTGGCTCCTGAAGCTGGGAGGGCGTGTGAAGACC
TGGAAGCGCCGGTGGTTCATCCTGACCGATAACTGCCTCTATTACTTTGAATACACAACA
GATAAGGAGCCCAGGGGAATCATCCCGTTGGAAAACCTCAGCATCAGGGAGGTGGAGGAC
CCCCGGAAACCCAACTGTTTTGAGCTCTACAATCCCAGCCACAAAGGGCAGGTCATCAAG
GCCTGTAAGACGGAGGCCGACGGCCGCGTGGTAGAGGGGAACCATGTGGTGTACCGGATC
TCAGCCCCGAGCCCGGAGGAGAAGGAGGAGTGGATGAAATCCATCAAAGCCAGTATCAGC
AGAGATCCCTTCTATGACATGTTGGCAACGAGGAAACGAAGGATTGCCAATAAAAAATAG
Protein Properties
Number of Residues 400
Molecular Weight 46348.2
Theoretical pI 5.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytohesin-3
MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYR
ISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
GenBank ID Protein 3297789
UniProtKB/Swiss-Prot ID O43739
UniProtKB/Swiss-Prot Entry Name CYH3_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ005197
GeneCard ID CYTH3
GenAtlas ID CYTH3
HGNC ID HGNC:9504
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  3. Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M: Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors. J Biol Chem. 2000 Feb 4;275(5):3221-30. [PubMed:10652308 ]
  4. Venkateswarlu K, Gunn-Moore F, Oatey PB, Tavare JM, Cullen PJ: Nerve growth factor- and epidermal growth factor-stimulated translocation of the ADP-ribosylation factor-exchange factor GRP1 to the plasma membrane of PC12 cells requires activation of phosphatidylinositol 3-kinase and the GRP1 pleckstrin homology domain. Biochem J. 1998 Oct 1;335 ( Pt 1):139-46. [PubMed:9742223 ]
  5. Franco M, Boretto J, Robineau S, Monier S, Goud B, Chardin P, Chavrier P: ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function. Proc Natl Acad Sci U S A. 1998 Aug 18;95(17):9926-31. [PubMed:9707577 ]