You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08341
Secondary Accession Numbers
  • 14053
Name Cytohesin-4
Synonyms
  1. PH, SEC7 and coiled-coil domain-containing protein 4
Gene Name CYTH4
Protein Type Unknown
Biological Properties
General Function Involved in ARF guanyl-nucleotide exchange factor activity
Specific Function Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
enzyme regulator activity
arf guanyl-nucleotide exchange factor activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
biological regulation
regulation of biological process
regulation of arf protein signal transduction
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.3-q13.1
SNPs CYTH4
Gene Sequence
>1185 bp
ATGGACCTGTGCCACCCAGAGCCCGCGGAGCTGAGCAGCGGGGAGACGGAAGAGTTACAG
AGGATCAAGTGGCACCGAAAGCAGCTCCTGGAGGACATCCAGAAGCTGAAGGATGAGATT
GCAGATGTGTTTGCCCAAATCGACTGCTTCGAGAGTGCGGAGGAGAGCCGGATGGCCCAG
AAGGAGAAGGAGCTGTGTATTGGGCGCAAGAAGTTCAACATGGACCCCGCCAAGGGTATC
CAGTATTTCATTGAGCACAAGCTGCTGACCCCTGACGTCCAGGACATTGCACGGTTCCTG
TATAAAGGCGAGGGCCTCAACAAGACAGCCATTGGTACCTACCTGGGGGAGAGGGATCCC
ATCAACCTGCAGGTCCTCCAGGCCTTCGTGGACTGCCACGAGTTCGCCAACCTCAACCTC
GTCCAGGCCCTCAGGCAGTTCCTGTGGAGCTTCCGGCTGCCGGGCGAGGCCCAGAAGATA
GACCGGATGATGGAGGCCTTTGCCACTCGATACTGCCTCTGCAACCCAGGCGTCTTCCAG
TCCACAGACACCTGCTACGTGTTGTCCTTCTCCATCATCATGCTCAACACCAGCCTCCAC
AATCCCAACGTCCGGGACAGGCCGCCTTTCGAGCGCTTTGTGTCCATGAACCGCGGCATC
AACAATGGTAGCGACCTGCCCGAGGACCAGCTGCGGAACCTCTTCGACAGCATCAAGAGT
GAGCCATTCTCCATCCCTGAGGACGACGGCAATGACCTCACTCACACCTTCTTCAATCCA
GACCGGGAGGGTTGGCTGCTCAAGCTAGGGGGCCGCGTGAAGACGTGGAAACGGCGCTGG
TTCATCCTGACCGACAACTGCCTCTACTACTTCGAGTTCACCACTGACAAGGAGCCACGG
GGAATTATACCTCTTGAGAACCTCTCGGTGCAGAAGGTGGATGACCCCAAGAAGCCATTC
TGCCTGGAGCTCTACAACCCTAGCTGCCGAGGCCAGAAAATCAAGGCCTGCAAGACCGAT
GGCGACGGCAGGGTGGTGGAGGGCAAGCACGAATCGTACCGCATCTCAGCCACCAGTGCC
GAGGAACGTGACCAGTGGATCGAGTCCATCCGAGCCAGCATCACCCGTGTCCCCTTCTAC
GACCTGGTCTCTACTCGGAAGAAGAAGATTGCCAGCAAGCAGTGA
Protein Properties
Number of Residues 394
Molecular Weight 45671.6
Theoretical pI 6.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cytohesin-4
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
GenBank ID Protein 6531383
UniProtKB/Swiss-Prot ID Q9UIA0
UniProtKB/Swiss-Prot Entry Name CYH4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF075458
GeneCard ID CYTH4
GenAtlas ID CYTH4
HGNC ID HGNC:9505
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M: Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors. J Biol Chem. 2000 Feb 4;275(5):3221-30. [PubMed:10652308 ]