You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08342
Secondary Accession Numbers
  • 14054
Name Disheveled-associated activator of morphogenesis 1
Synonyms Not Available
Gene Name DAAM1
Protein Type Unknown
Biological Properties
General Function Involved in actin binding
Specific Function Binds to disheveled (Dvl) and Rho, and mediates Wnt- induced Dvl-Rho complex formation. May play a role as a scaffolding protein to recruit Rho-GDP and Rho-GEF, thereby enhancing Rho-GTP formation. Can direct nucleation and elongation of new actin filaments
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
cytoskeletal protein binding
actin binding
gtpase binding
small gtpase binding
ras gtpase binding
rho gtpase binding
enzyme binding
Process
cytoskeleton organization
actin cytoskeleton organization
cellular process
cellular component organization at cellular level
organelle organization
cellular component organization or biogenesis
cellular component organization
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 14q23.1
SNPs DAAM1
Gene Sequence
>3237 bp
ATGGCCCCAAGAAAGAGAGGTGGACGAGGTATTTCATTCATCTTTTGCTGTTTCCGAAAT
AATGATCACCCAGAAATCACGTATCGGCTGCGAAATGATAGCAACTTTGCGCTTCAGACC
ATGGAACCAGCATTGCCCATGCCCCCTGTGGAGGAGCTGGATGTCATGTTCAGTGAACTG
GTGGATGAACTGGACCTCACAGACAAACACAGAGAAGCCATGTTTGCACTTCCAGCTGAG
AAAAAATGGCAAATATACTGTAGCAAGAAAAAGGACCAGGAAGAAAACAAGGGAGCTACA
AGTTGGCCTGAATTCTACATTGATCAGCTCAATTCCATGGCTGCTAGAAAATCTCTGCTG
GCTTTAGAGAAGGAAGAAGAAGAAGAAAGAAGTAAAACTATAGAGAGTTTAAAGACAGCA
CTGAGGACAAAACCAATGAGGTTTGTAACCAGATTCATCGACTTGGATGGCCTATCATGT
ATCCTCAACTTTCTAAAGACCATGGACTACGAGACCTCAGAGTCTCGAATACATACTTCT
CTCATTGGCTGTATAAAGGCGTTAATGAACAACTCTCAAGGCCGGGCTCACGTCCTGGCT
CATTCTGAGAGTATTAATGTAATTGCTCAGAGTCTGAGCACAGAGAACATTAAAACGAAG
GTGGCCGTGCTGGAAATCTTGGGCGCCGTGTGCCTGGTTCCCGGGGGCCACAAGAAGGTT
CTGCAGGCCATGCTGCACTACCAGAAGTATGCCAGCGAAAGGACCCGCTTTCAGACATTA
ATTAACGACTTGGATAAAAGCACTGGGCGGTATCGAGATGAAGTGAGTCTCAAGACTGCC
ATCATGTCCTTCATTAATGCAGTGCTCAGCCAAGGTGCAGGAGTGGAGAGTTTGGACTTT
AGACTTCATCTTCGCTATGAATTTCTGATGTTAGGAATTCAACCTGTAATAGATAAATTA
AGGGAACACGAAAATTCAACATTAGATAGGCATTTAGACTTTTTTGAAATGCTCCGAAAT
GAAGATGAACTAGAATTTGCCAAAAGATTTGAACTGGTTCACATAGACACAAAAAGTGCA
ACTCAGATGTTTGAGCTGACCAGGAAGAGGCTGACACATAGTGAAGCTTACCCGCATTTC
ATGTCCATCCTGCACCACTGCCTCCAAATGCCTTACAAGAGGAGTGGCAACACTGTTCAG
TACTGGCTACTACTAGATAGAATTATACAGCAGATAGTTATCCAGAATGACAAAGGACAG
GACCCTGACTCCACACCTTTGGAAAACTTTAATATTAAGAATGTCGTACGAATGTTGGTT
AATGAAAATGAAGTTAAGCAGTGGAAAGAACAAGCGGAAAAAATGAGAAAAGAGCACAAT
GAGCTACAACAGAAACTGGAAAAGAAAGAACGAGAATGTGATGCTAAGACTCAAGAGAAG
GAAGAGATGATGCAGACCTTAAATAAAATGAAAGAGAAACTTGAAAAGGAGACTACTGAG
CATAAGCAAGTCAAGCAGCAGGTGGCGGACCTCACAGCACAGCTCCATGAGCTCAGCAGG
AGGGCCGTCTGTGCTTCAATCCCAGGTGGACCCTCGCCTGGAGCACCAGGAGGGCCCTTT
CCTTCCTCTGTGCCTGGATCTCTCCTTCCTCCCCCACCACCCCCACCTCTACCAGGTGGG
ATGCTTCCCCCTCCACCGCCTCCCCTCCCTCCAGGTGGCCCTCCTCCTCCCCCAGGGCCT
CCTCCCTTAGGGGCAATCATGCCACCTCCTGGTGCTCCAATGGGCCTAGCACTGAAGAAG
AAAAGCATTCCTCAGCCCACAAATGCCCTGAAATCCTTCAACTGGTCTAAACTGCCCGAG
AACAAACTGGAAGGAACAGTATGGACCGAAATTGATGATACAAAAGTCTTCAAAATTCTA
GATCTTGAAGACCTGGAAAGAACCTTCTCTGCCTATCAAAGACAGCAGGATTTCTTTGTG
AACAGTAACTCCAAGCAGAAAGAAGCAGATGCCATTGATGACACTCTGAGTTCCAAACTT
AAAGTTAAAGAGCTTTCGGTGATTGATGGTCGGAGAGCTCAGAATTGCAACATCCTTCTA
TCGAGGTTGAAATTATCCAATGACGAAATCAAACGGGCAATTCTAACAATGGACGAACAG
GAAGATCTGCCCAAGGACATGTTGGAACAGCTCTTGAAATTTGTTCCTGAAAAAAGTGAC
ATTGACCTATTGGAGGAACATAAACACGAACTGGATCGGATGGCCAAGGCTGATAGGTTC
CTTTTTGAGATGAGCCGAATTAATCACTATCAGCAAAGGTTGCAATCGCTGTACTTCAAA
AAGAAGTTTGCAGAGCGTGTGGCAGAAGTGAAACCTAAAGTGGAAGCAATTCGTTCTGGC
TCAGAAGAGGTGTTTAGGAGTGGTGCCCTCAAGCAGTTGCTGGAGGTGGTTTTGGCATTT
GGAAATTATATGAATAAAGGTCAAAGAGGGAATGCATATGGATTCAAGATATCTAGCCTA
AACAAAATTGCTGACACAAAATCCAGCATCGACAAAAACATTACCCTTTTGCACTATCTC
ATCACTATTGTGGAAAATAAGTACCCCAGTGTTCTCAATCTAAATGAAGAATTGCGAGAT
ATTCCTCAAGCTGCGAAAGTAAACATGACTGAGCTGGACAAAGAAATAAGTACCTTGAGA
AGTGGCTTGAAAGCAGTAGAGACAGAGCTGGAATATCAGAAGTCTCAGCCCCCACAGCCC
GGAGATAAGTTTGTGTCTGTTGTCAGCCAGTTCATCACAGTAGCCAGCTTCAGCTTCTCT
GATGTTGAAGACCTTCTAGCAGAAGCTAAAGACCTGTTTACTAAAGCAGTGAAGCACTTT
GGGGAAGAGGCTGGCAAAATACAACCAGATGAGTTCTTTGGCATTTTTGATCAATTTCTT
CAAGCTGTGTCAGAAGCCAAACAAGAAAACGAAAATATGAGAAAGAAAAAGGAGGAAGAA
GAACGTCGAGCTCGCATGGAAGCTCAGCTCAAAGAACAACGTGAAAGGGAACGTAAAATG
AGAAAAGCTAAAGAGAATAGTGAAGAAAGCGGAGAGTTTGATGACCTTGTTTCAGCTTTA
CGCTCAGGAGAAGTGTTTGACAAAGACCTTTCTAAATTGAAACGGAATCGCAAACGTATT
ACCAACCAGATGACTGACAGCAGCAGAGAGAGACCAATCACAAAACTTAATTTCTAA
Protein Properties
Number of Residues 1078
Molecular Weight 123472.4
Theoretical pI 7.24
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Disheveled-associated activator of morphogenesis 1
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSEL
VDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLL
ALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTS
LIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKV
LQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDF
RLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSA
TQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEK
EEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPF
PSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKK
KSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFV
NSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQ
EDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFK
KKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLR
SGLKAVETELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHF
GEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKM
RKAKENSEESGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQMTDSSRERPITKLNF
GenBank ID Protein 21071077
UniProtKB/Swiss-Prot ID Q9Y4D1
UniProtKB/Swiss-Prot Entry Name DAAM1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014992.1
GeneCard ID DAAM1
GenAtlas ID DAAM1
HGNC ID HGNC:18142
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  4. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  5. Aspenstrom P, Richnau N, Johansson AS: The diaphanous-related formin DAAM1 collaborates with the Rho GTPases RhoA and Cdc42, CIP4 and Src in regulating cell morphogenesis and actin dynamics. Exp Cell Res. 2006 Jul 15;312(12):2180-94. Epub 2006 Apr 21. [PubMed:16630611 ]
  6. Habas R, Kato Y, He X: Wnt/Frizzled activation of Rho regulates vertebrate gastrulation and requires a novel Formin homology protein Daam1. Cell. 2001 Dec 28;107(7):843-54. [PubMed:11779461 ]
  7. Lu J, Meng W, Poy F, Maiti S, Goode BL, Eck MJ: Structure of the FH2 domain of Daam1: implications for formin regulation of actin assembly. J Mol Biol. 2007 Jun 22;369(5):1258-69. Epub 2007 Apr 5. [PubMed:17482208 ]