Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08349
Secondary Accession Numbers
  • 14061
Name Dynamin-1-like protein
Synonyms
  1. DVLP
  2. Dnm1p/Vps1p-like protein
  3. Dymple
  4. Dynamin family member proline-rich carboxyl-terminal domain less
  5. Dynamin-like protein
  6. Dynamin-like protein 4
  7. Dynamin-like protein IV
  8. Dynamin-related protein 1
  9. HdynIV
Gene Name DNM1L
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. Required for programmed necrosis execution. May be involved in vesicle transport. Isoform 1 and isoform 4 inhibit peroxisomal division when overexpressed.
Pathways
  • Bacterial invasion of epithelial cells
  • Endocrine and other factor-regulated calcium reabsorption
  • Endocytosis
  • Fc gamma R-mediated phagocytosis
  • Synaptic vesicle cycle
Reactions
Guanosine triphosphate + Water → Guanosine diphosphate + Phosphate details
GO Classification
Biological Process
mitochondrion morphogenesis
cellular component disassembly involved in execution phase of apoptosis
dynamin polymerization involved in mitochondrial fission
GTP catabolic process
membrane fission involved in mitochondrial fission
mitochondrial fragmentation involved in apoptotic process
positive regulation of intrinsic apoptotic signaling pathway
positive regulation of mitochondrial fission
positive regulation of release of cytochrome c from mitochondria
regulation of peroxisome organization
positive regulation of protein secretion
peroxisome fission
protein homotetramerization
Cellular Component
cytosol
Golgi apparatus
perinuclear region of cytoplasm
mitochondrial outer membrane
peroxisome
endomembrane system
microtubule
protein complex
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Molecular Function
GTPase activity
GTP binding
Cellular Location
  1. Cytoplasm
  2. Endomembrane system
  3. Peripheral membrane protein
  4. Golgi apparatus
  5. cytosol
Gene Properties
Chromosome Location 12
Locus 12p11.21
SNPs DNM1L
Gene Sequence
>2211 bp
ATGGAGGCGCTAATTCCTGTCATAAACAAGCTCCAGGACGTCTTCAACACGGTGGGCGCC
GACATCATCCAGCTGCCTCAAATCGTCGTAGTGGGAACGCAGAGCAGCGGAAAGAGCTCA
GTGCTAGAAAGCCTGGTGGGGAGGGACCTGCTTCCCAGAGGTACTGGAATTGTCACCCGG
AGACCTCTCATTCTGCAACTGGTCCATGTTTCACAAGAAGATAAACGGAAAACAACAGGA
GAAGAAAATGGGGTGGAAGCAGAAGAATGGGGTAAATTTCTTCACACCAAAAATAAGCTT
TACACGGATTTTGATGAAATTCGACAAGAAATTGAAAATGAAACAGAAAGAATTTCAGGA
AATAATAAGGGAGTAAGCCCTGAACCAATTCATCTTAAGATTTTTTCACCCAACGTTGTC
AATTTGACACTTGTGGATTTGCCAGGAATGACCAAGGTGCCTGTAGGTGATCAACCTAAG
GATATTGAGCTTCAAATCAGAGAGCTCATTCTTCGGTTCATCAGTAATCCTAATTCCATT
ATCCTCGCTGTCACTGCTGCTAATACAGATATGGCAACATCAGAGGCACTTAAAATTTCA
AGAGAGGTAGATCCAGATGGTCGCAGAACCCTAGCTGTAATCACTAAACTTGATCTCATG
GATGCGGGTACTGATGCCATGGATGTATTGATGGGAAGGGTTATTCCAGTCAAACTTGGA
ATAATTGGAGTAGTTAACAGGAGCCAGCTAGATATTAACAACAAGAAGAGTGTAACTGAT
TCAATCCGTGATGAGTATGCTTTTCTTCAAAAGAAATATCCATCTCTGGCCAATAGAAAT
GGAACAAAGTATCTTGCTAGGACTCTAAACAGGTTACTGATGCATCACATCAGAGATTGT
TTACCAGAGTTGAAAACAAGAATAAATGTTCTAGCTGCTCAGTATCAGTCTCTTCTAAAT
AGCTACGGTGAACCCGTGGATGATAAAAGTGCTACTTTACTCCAACTTATTACCAAATTT
GCCACAGAATATTGTAACACTATTGAAGGAACTGCAAAATATATTGAAACTTCGGAGCTA
TGCGGTGGTGCTAGAATTTGTTATATTTTCCATGAGACTTTTGGGCGAACCTTAGAATCT
GTTGATCCACTTGGTGGCCTTAACACTATTGACATTTTGACTGCCATTAGAAATGCTACT
GGTCCTCGTCCTGCTTTATTTGTGCCTGAGGTTTCATTTGAGTTACTGGTGAAGCGGCAA
ATCAAACGTCTAGAAGAGCCCAGCCTCCGCTGTGTGGAACTGGTTCATGAGGAAATGCAA
AGGATCATTCAGCACTGTAGCAATTACAGTACACAGGAATTGTTACGATTTCCTAAACTT
CATGATGCCATAGTTGAAGTGGTGACTTGTCTTCTTCGTAAAAGGTTGCCTGTTACAAAT
GAAATGGTCCATAACTTAGTGGCAATTGAACTGGCTTATATCAACACAAAACATCCAGAC
TTTGCTGATGCTTGTGGGCTAATGAACAATAATATAGAGGAACAAAGGAGAAACAGGCTA
GCCAGAGAATTACCTTCAGCTGTATCACGAGACAAGTCTTCTAAAGTTCCAAGTGCTTTG
GCACCTGCCTCCCAGGAGCCCTCCCCCGCTGCTTCTGCTGAGGCTGATGGCAAGTTAATT
CAGGACAGCAGAAGAGAAACTAAAAATGTTGCATCTGGAGGTGGTGGGGTTGGAGATGGT
GTTCAAGAACCAACCACAGGCAACTGGAGAGGAATGCTGAAAACTTCAAAAGCTGAAGAG
TTATTAGCAGAAGAAAAATCAAAACCCATTCCAATTATGCCAGCCAGTCCACAAAAAGGT
CATGCCGTGAACCTGCTAGATGTGCCAGTTCCTGTTGCACGAAAACTATCTGCTCGGGAA
CAGCGAGATTGTGAGGTTATTGAACGACTCATTAAATCATATTTTCTCATTGTCAGAAAG
AATATTCAAGACAGTGTGCCAAAGGCAGTAATGCATTTTTTGGTTAATCATGTGAAAGAC
ACTCTTCAGAGTGAGCTAGTAGGCCAGCTGTATAAATCATCCTTATTGGATGATCTTCTG
ACAGAATCTGAGGACATGGCACAGCGCAGGAAAGAAGCAGCTGATATGCTAAAGGCATTA
CAAGGAGCCAGTCAAATTATTGCTGAAATCCGGGAGACTCATCTTTGGTGA
Protein Properties
Number of Residues 736
Molecular Weight 78099.3
Theoretical pI 6.811
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dynamin-1-like protein
MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTR
RPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISG
NNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSI
ILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLG
IIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC
LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSEL
CGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQ
IKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTN
EMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSAL
APASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEE
LLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRK
NIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKAL
QGASQIIAEIRETHLW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O00429
UniProtKB/Swiss-Prot Entry Name DNM1L_HUMAN
PDB IDs Not Available
GenBank Gene ID AB006965
GeneCard ID DNM1L
GenAtlas ID DNM1L
HGNC ID HGNC:2973
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  7. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  8. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  11. Figueroa-Romero C, Iniguez-Lluhi JA, Stadler J, Chang CR, Arnoult D, Keller PJ, Hong Y, Blackstone C, Feldman EL: SUMOylation of the mitochondrial fission protein Drp1 occurs at multiple nonconsensus sites within the B domain and is linked to its activity cycle. FASEB J. 2009 Nov;23(11):3917-27. doi: 10.1096/fj.09-136630. Epub 2009 Jul 28. [PubMed:19638400 ]
  12. Hong YR, Chen CH, Cheng DS, Howng SL, Chow CC: Human dynamin-like protein interacts with the glycogen synthase kinase 3beta. Biochem Biophys Res Commun. 1998 Aug 28;249(3):697-703. [PubMed:9731200 ]
  13. Cereghetti GM, Stangherlin A, Martins de Brito O, Chang CR, Blackstone C, Bernardi P, Scorrano L: Dephosphorylation by calcineurin regulates translocation of Drp1 to mitochondria. Proc Natl Acad Sci U S A. 2008 Oct 14;105(41):15803-8. doi: 10.1073/pnas.0808249105. Epub 2008 Oct 6. [PubMed:18838687 ]
  14. Shin HW, Shinotsuka C, Torii S, Murakami K, Nakayama K: Identification and subcellular localization of a novel mammalian dynamin-related protein homologous to yeast Vps1p and Dnm1p. J Biochem. 1997 Sep;122(3):525-30. [PubMed:9348079 ]
  15. Imoto M, Tachibana I, Urrutia R: Identification and functional characterization of a novel human protein highly related to the yeast dynamin-like GTPase Vps1p. J Cell Sci. 1998 May;111 ( Pt 10):1341-9. [PubMed:9570752 ]
  16. Chen CH, Howng SL, Hwang SL, Chou CK, Liao CH, Hong YR: Differential expression of four human dynamin-like protein variants in brain tumors. DNA Cell Biol. 2000 Mar;19(3):189-94. [PubMed:10749171 ]
  17. Kamimoto T, Nagai Y, Onogi H, Muro Y, Wakabayashi T, Hagiwara M: Dymple, a novel dynamin-like high molecular weight GTPase lacking a proline-rich carboxyl-terminal domain in mammalian cells. J Biol Chem. 1998 Jan 9;273(2):1044-51. [PubMed:9422767 ]
  18. Yoon Y, Pitts KR, Dahan S, McNiven MA: A novel dynamin-like protein associates with cytoplasmic vesicles and tubules of the endoplasmic reticulum in mammalian cells. J Cell Biol. 1998 Feb 23;140(4):779-93. [PubMed:9472031 ]
  19. Smirnova E, Shurland DL, Ryazantsev SN, van der Bliek AM: A human dynamin-related protein controls the distribution of mitochondria. J Cell Biol. 1998 Oct 19;143(2):351-8. [PubMed:9786947 ]
  20. Shin HW, Takatsu H, Mukai H, Munekata E, Murakami K, Nakayama K: Intermolecular and interdomain interactions of a dynamin-related GTP-binding protein, Dnm1p/Vps1p-like protein. J Biol Chem. 1999 Jan 29;274(5):2780-5. [PubMed:9915810 ]
  21. Smirnova E, Griparic L, Shurland DL, van der Bliek AM: Dynamin-related protein Drp1 is required for mitochondrial division in mammalian cells. Mol Biol Cell. 2001 Aug;12(8):2245-56. [PubMed:11514614 ]
  22. Koch A, Thiemann M, Grabenbauer M, Yoon Y, McNiven MA, Schrader M: Dynamin-like protein 1 is involved in peroxisomal fission. J Biol Chem. 2003 Mar 7;278(10):8597-605. Epub 2002 Dec 23. [PubMed:12499366 ]
  23. Li X, Gould SJ: The dynamin-like GTPase DLP1 is essential for peroxisome division and is recruited to peroxisomes in part by PEX11. J Biol Chem. 2003 May 9;278(19):17012-20. Epub 2003 Mar 4. [PubMed:12618434 ]
  24. Zhu PP, Patterson A, Stadler J, Seeburg DP, Sheng M, Blackstone C: Intra- and intermolecular domain interactions of the C-terminal GTPase effector domain of the multimeric dynamin-like GTPase Drp1. J Biol Chem. 2004 Aug 20;279(34):35967-74. Epub 2004 Jun 18. [PubMed:15208300 ]
  25. Yonashiro R, Ishido S, Kyo S, Fukuda T, Goto E, Matsuki Y, Ohmura-Hoshino M, Sada K, Hotta H, Yamamura H, Inatome R, Yanagi S: A novel mitochondrial ubiquitin ligase plays a critical role in mitochondrial dynamics. EMBO J. 2006 Aug 9;25(15):3618-26. Epub 2006 Jul 27. [PubMed:16874301 ]
  26. Nakamura N, Kimura Y, Tokuda M, Honda S, Hirose S: MARCH-V is a novel mitofusin 2- and Drp1-binding protein able to change mitochondrial morphology. EMBO Rep. 2006 Oct;7(10):1019-22. Epub 2006 Aug 25. [PubMed:16936636 ]
  27. Parone PA, James DI, Da Cruz S, Mattenberger Y, Donze O, Barja F, Martinou JC: Inhibiting the mitochondrial fission machinery does not prevent Bax/Bak-dependent apoptosis. Mol Cell Biol. 2006 Oct;26(20):7397-408. [PubMed:17015472 ]
  28. Taguchi N, Ishihara N, Jofuku A, Oka T, Mihara K: Mitotic phosphorylation of dynamin-related GTPase Drp1 participates in mitochondrial fission. J Biol Chem. 2007 Apr 13;282(15):11521-9. Epub 2007 Feb 14. [PubMed:17301055 ]
  29. Chang CR, Blackstone C: Cyclic AMP-dependent protein kinase phosphorylation of Drp1 regulates its GTPase activity and mitochondrial morphology. J Biol Chem. 2007 Jul 27;282(30):21583-7. Epub 2007 Jun 6. [PubMed:17553808 ]
  30. Karbowski M, Neutzner A, Youle RJ: The mitochondrial E3 ubiquitin ligase MARCH5 is required for Drp1 dependent mitochondrial division. J Cell Biol. 2007 Jul 2;178(1):71-84. [PubMed:17606867 ]
  31. Han XJ, Lu YF, Li SA, Kaitsuka T, Sato Y, Tomizawa K, Nairn AC, Takei K, Matsui H, Matsushita M: CaM kinase I alpha-induced phosphorylation of Drp1 regulates mitochondrial morphology. J Cell Biol. 2008 Aug 11;182(3):573-85. doi: 10.1083/jcb.200802164. [PubMed:18695047 ]
  32. Zunino R, Braschi E, Xu L, McBride HM: Translocation of SenP5 from the nucleoli to the mitochondria modulates DRP1-dependent fission during mitosis. J Biol Chem. 2009 Jun 26;284(26):17783-95. doi: 10.1074/jbc.M901902200. Epub 2009 May 1. [PubMed:19411255 ]
  33. Cho DH, Nakamura T, Fang J, Cieplak P, Godzik A, Gu Z, Lipton SA: S-nitrosylation of Drp1 mediates beta-amyloid-related mitochondrial fission and neuronal injury. Science. 2009 Apr 3;324(5923):102-5. doi: 10.1126/science.1171091. [PubMed:19342591 ]
  34. Bonekamp NA, Vormund K, Jacob R, Schrader M: Dynamin-like protein 1 at the Golgi complex: a novel component of the sorting/targeting machinery en route to the plasma membrane. Exp Cell Res. 2010 Dec 10;316(20):3454-67. doi: 10.1016/j.yexcr.2010.07.020. Epub 2010 Aug 3. [PubMed:20688057 ]
  35. Waterham HR, Koster J, van Roermund CW, Mooyer PA, Wanders RJ, Leonard JV: A lethal defect of mitochondrial and peroxisomal fission. N Engl J Med. 2007 Apr 26;356(17):1736-41. [PubMed:17460227 ]