Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08351
Secondary Accession Numbers
  • 14063
Name Dedicator of cytokinesis protein 11
Synonyms
  1. ACG
  2. Activated Cdc42-associated guanine nucleotide exchange factor
  3. Zizimin-2
Gene Name DOCK11
Protein Type Unknown
Biological Properties
General Function Involved in guanyl-nucleotide exchange factor activity
Specific Function Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
enzyme regulator activity
protein binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs DOCK11
Gene Sequence
>6222 bp
ATGGCCGAAGTGCGCAAATTCACCAAACGGCTCAGCAAGCCTGGCACGGCGGCTGAGCTC
CGGCAGAGCGTGTCTGAGGCCGTGCGGGGCTCCGTGGTGCTGGAAAAGGCCAAAGTTGTT
GAGCCCCTGGACTATGAGAATGTTATTGCCCAAAGAAAAACCCAGATTTACAGCGACCCC
CTCCGAGATCTGCTTATGTTCCCAATGGAAGATATATCTATCTCGGTGATAGGTCGTCAA
CGCAGAACGGTGCAGTCTACTGTACCAGAAGATGCTGAAAAGAGGGCCCAGAGTTTATTT
GTTAAAGAGTGTATTAAAACCTATAGCACAGATTGGCACGTGGTAAACTACAAGTATGAG
GACTTCTCTGGGGACTTTCGAATGTTGCCATGTAAATCTTTGAGACCAGAAAAGATTCCT
AATCATGTATTTGAGATAGATGAAGACTGTGAGAAAGATGAGGACTCATCTTCTTTATGT
TCTCAGAAGGGTGGTGTGATAAAACAAGGCTGGTTGCATAAAGCAAATGTAAATAGTACC
ATCACAGTAACCATGAAGGTATTCAAGAGACGATATTTTTACTTGACCCAACTTCCTGAC
GGTTCATATATTCTCAATTCCTATAAAGATGAGAAAAATTCAAAAGAATCGAAAGGTTGC
ATCTACTTGGACGCCTGCATTGATGTTGTTCAGTGCCCCAAAATGCGCCGTCATGCTTTT
GAACTCAAGATGTTAGATAAATATAGCCATTATCTGGCTGCTGAAACTGAGCAGGAAATG
GAGGAATGGTTGATAACTTTGAAAAAGATTATTCAGATCAACACCGACAGTTTAGTTCAA
GAAAAAAAGGAGACGGTAGAAACAGCACAAGATGATGAAACTAGCAGCCAAGGAAAAGCC
GAGAACATCATGGCAAGTTTGGAAAGGAGCATGCATCCGGAACTGATGAAGTATGGAAGA
GAAACTGAACAACTAAACAAACTCAGTAGAGGAGATGGAAGACAGAATCTCTTTTCTTTT
GATTCAGAAGTTCAGAGGTTGGACTTTTCAGGAATTGAACCTGATATAAAGCCATTTGAA
GAAAAATGCAATAAACGTTTCCTGGTGAATTGCCATGATTTAACTTTCAATATCTTGGGC
CAAATTGGAGACAATGCAAAAGGACCACCCACAAATGTTGAGCCCTTTTTTATCAATCTT
GCCTTATTTGATGTAAAGAACAATTGTAAGATTTCAGCAGACTTTCATGTAGACCTGAAT
CCCCCATCTGTCCGTGAAATGCTGTGGGGCTCTTCAACCCAACTGGCCAGTGACGGTAGC
CCAAAGGGCTCTTCACCCGAATCTTACATTCATGGAATTGCCGAATCTCAGTTACGCTAC
ATACAACAGGGAATTTTCTCAGTGACGAATCCACATCCTGAAATTTTTCTAGTTGCCAGA
ATTGAAAAGGTACTACAGGGAAACATTACACACTGTGCAGAACCCTATATCAAAAATTCT
GATCCAGTAAAGACGGCCCAGAAGGTGCACAGGACAGCTAAACAAGTGTGTAGCCGCCTT
GGACAATACAGAATGCCCTTCGCTTGGGCTGCCAGACCCATTTTCAAAGATACTCAAGGC
TCTCTTGATCTGGATGGGAGATTTTCTCCTCTGTATAAACAAGACAGTAGCAAGCTTTCA
AGTGAAGACATTCTCAAGTTGCTCTCAGAATATAAGAAGCCAGAAAAGACCAAACTGCAG
ATTATTCCTGGGCAGCTAAACATCACAGTAGAATGTGTTCCTGTGGATTTATCAAATTGT
ATTACTTCTTCATATGTGCCCTTGAAGCCTTTTGAAAAGAATTGCCAAAATATTACTGTG
GAGGTTGAAGAGTTTGTTCCAGAAATGACAAAATATTGTTATCCATTTACTATTTACAAA
AACCATCTGTATGTATATCCCCTGCAATTAAAATACGATAGCCAGAAAACATTTGCCAAG
GCAAGGAACATTGCAGTCTGTGTGGAATTCCGGGATTCAGATGAAAGTGACGCTAGTGCC
CTAAAGTGTATTTATGGAAAACCTGCAGGGTCTGTTTTTACCACAAATGCTTATGCTGTT
GTCTCGCATCACAACCAAAATCCAGAGTTCTATGATGAGATTAAAATTGAGCTTCCCATT
CACCTACATCAAAAACATCATTTGCTTTTCACTTTTTATCATGTAAGTTGTGAAATTAAC
ACAAAGGGAACAACCAAAAAGCAAGACACAGTTGAAACTCCAGTTGGGTTTGCCTGGGTA
CCTTTGCTGAAAGATGGTAGAATCATCACATTTGAGCAGCAGCTGCCAGTTTCCGCCAAT
CTTCCCCCAGGCTACTTGAATCTGAATGATGCAGAATCAAGAAGGCAATGTAACGTGGAT
ATTAAATGGGTAGATGGTGCAAAGCCTTTGTTGAAGATTAAAAGCCACTTAGAATCTACC
ATTTACACTCAAGATCTGCATGTGCACAAATTCTTCCATCATTGCCAGCTGATTCAGTCA
GGCTCGAAAGAAGTTCCAGGGGAGCTCATTAAATATTTAAAGTGTTTGCATGCCATGGAG
ATCCAAGTCATGATACAGTTTCTACCTGTAATTCTTATGCAACTCTTCCGAGTTCTCACA
AATATGACCCATGAAGATGACGTTCCTATCAACTGCACCATGGTTCTCTTACATATTGTA
TCAAAGTGCCATGAAGAAGGCTTGGATAGTTATCTAAGATCATTCATAAAGTATAGCTTC
CGACCTGAAAAACCGAGTGCTCCTCAGGCCCAGCTGATACATGAAACCCTGGCTACTACG
ATGATAGCAATATTGAAACAGTCTGCAGATTTTTTATCAATAAACAAATTGCTAAAGTAC
TCATGGTTTTTCTTTGAAATAATTGCAAAGTCAATGGCCACATACTTGTTGGAAGAGAAT
AAGATTAAGCTTCCCCGAGGCCAGAGATTTCCCGAGACATATCATCATGTCTTACATTCA
CTGCTTCTTGCAATAATTCCCCATGTGACTATTCGGTATGCGGAGATTCCCGATGAGTCC
AGAAATGTGAACTATAGTTTGGCTAGCTTCCTGAAGCGCTGTTTGACACTAATGGATAGA
GGATTTATTTTCAATTTAATAAATGACTATATATCTGGATTCAGCCCCAAAGATCCTAAG
GTTCTGGCTGAATACAAGTTTGAATTTCTGCAAACAATTTGCAATCACGAACATTACATT
CCTCTGAACTTGCCAATGGCATTTGCAAAACCTAAACTGCAGCGGGTTCAAGATTCAAAT
CTTGAATACAGTTTATCAGATGAGTATTGCAAGCATCACTTCTTGGTTGGTCTACTTCTG
AGGGAAACTTCCATTGCTCTTCAGGACAATTATGAGATCAGATATACAGCTATCTCTGTT
ATAAAGAATCTTTTGATAAAACATGCATTTGACACAAGATACCAGCACAAGAACCAACAA
GCCAAAATAGCACAATTGTACCTCCCCTTTGTTGGACTACTTTTGGAAAATATACAGCGA
TTAGCAGGTCGAGATACCTTGTATTCTTGTGCAGCCATGCCTAATTCTGCATCCAGAGAT
GAGTTTCCATGTGGCTTTACTTCACCTGCCAATAGAGGGAGTCTGAGCACTGACAAAGAC
ACCGCTTATGGGTCTTTTCAAAATGGACATGGAATTAAGAGAGAAGATTCAAGAGGTTCC
CTCATCCCAGAAGGAGCAACAGGATTTCCAGATCAGGGCAACACTGGTGAAAATACCCGA
CAGAGTTCTACAAGGAGTAGTGTATCCCAGTATAACCGCCTGGATCAGTATGAAATCAGA
AGCCTCCTGATGTGCTACCTGTATATAGTAAAAATGATTTCAGAAGATACTCTCTTAACT
TACTGGAATAAAGTATCACCTCAGGAGCTCATAAACATTCTTATACTTTTAGAAGTATGC
TTGTTTCACTTTAGATATATGGGGAAAAGAAACATAGCAAGGGTGCATGATGCCTGGCTG
TCAAAACACTTCGGAATAGACCGAAAATCGCAAACCATGCCTGCTCTTCGAAACAGATCA
GGAGTAATGCAGGCCCGGCTTCAGCATCTTAGTAGCCTAGAAAGTTCATTTACACTTAAT
CACAGTTCTACAACAACTGAAGCAGACATTTTCCACCAGGCACTTCTTGAAGGCAATACA
GCTACTGAAGTTTCCCTAACAGTACTAGACACCATATCATTTTTCACTCAGTGCTTCAAG
ACCCAACTTTTAAATAATGATGGCCATAACCCATTAATGAAAAAAGTGTTTGATATACAT
CTTGCTTTTCTTAAAAATGGACAATCTGAAGTGTCGCTGAAACATGTATTTGCCTCACTG
AGAGCTTTCATCAGTAAGTTTCCTTCAGCATTTTTCAAAGGAAGAGTAAACATGTGTGCT
GCATTTTGCTATGAGGTTTTAAAGTGCTGCACATCGAAGATTAGCTCAACCAGGAATGAA
GCATCTGCACTTTTGTATCTTTTGATGAGAAACAACTTTGAGTATACCAAAAGGAAAACC
TTTTTGAGGACACATCTACAGATAATAATTGCTGTAAGCCAACTGATAGCTGATGTAGCA
CTAAGCGGAGGATCAAGATTTCAGGAGTCTTTATTCATTATCAATAATTTTGCAAATAGT
GACAGACCTATGAAGGCAACTGCCTTTCCCGCAGAAGTCAAAGACTTGACCAAGAGAATC
CGCACTGTTCTTATGGCCACTGCCCAAATGAAGGAGCATGAGAAAGACCCTGAAATGCTA
ATTGATCTCCAGTATAGCTTAGCCAAGTCCTATGCAAGCACCCCAGAGCTCAGGAAAACC
TGGCTTGATAGCATGGCCAAGATTCATGTAAAAAATGGAGATTTTTCAGAGGCTGCGATG
TGTTATGTCCATGTAGCAGCTCTAGTTGCAGAGTTTCTTCATCGAAAAAAATTATTTCCT
AACGGATGTTCAGCGTTCAAGAAAATTACTCCCAATATAGATGAAGAAGGAGCAATGAAA
GAAGATGCTGGGATGATGGATGTCCATTATAGTGAAGAGGTCTTGCTGGAGTTGCTAGAA
CAATGTGTGGATGGCTTATGGAAGGCAGAACGTTATGAAATAATTTCTGAGATTTCCAAG
TTGATCGTTCCAATTTATGAGAAACGTCGTGAGTTTGAGAAACTTACTCAAGTTTATAGA
ACTCTTCATGGAGCTTACACAAAAATTCTGGAAGTTATGCATACAAAAAAGAGACTTTTA
GGCACTTTCTTCAGAGTTGCCTTTTATGGCCAATCTTTTTTTGAAGAAGAAGATGGAAAG
GAGTACATCTATAAAGAACCAAAGCTCACTGGCCTCTCAGAAATTTCCTTGAGACTTGTT
AAACTTTATGGTGAAAAGTTTGGTACGGAGAATGTCAAAATAATTCAGGATTCAGACAAG
GTAAATGCCAAAGAGCTTGATCCAAAATATGCTCATATACAAGTTACTTATGTGAAGCCT
TACTTTGATGACAAAGAACTCACAGAAAGGAAGACCGAGTTTGAAAGAAATCATAATATC
AGCAGATTTGTTTTTGAGGCCCCTTACACTTTATCAGGCAAAAAACAGGGCTGTATAGAA
GAACAGTGCAAACGCCGTACAATCTTGACAACTTCAAACTCGTTTCCTTACGTGAAGAAG
AGGATTCCTATTAACTGTGAACAGCAGATTAATTTAAAACCAATTGATGTTGCCACTGAT
GAAATAAAAGATAAAACTGCAGAGCTGCAAAAGCTTTGCTCCTCTACTGACGTGGACATG
ATTCAGCTCCAACTTAAATTGCAGGGCTGTGTTTCTGTGCAGGTCAATGCTGGTCCATTA
GCATATGCAAGAGCTTTCTTAAATGACAGCCAAGCTAGCAAGTATCCACCTAAGAAAGTG
AGTGAGTTGAAAGACATGTTTAGGAAATTTATACAAGCATGCAGCATTGCACTTGAACTA
AATGAGCGGCTAATTAAAGAAGATCAAGTTGAGTACCATGAAGGGCTAAAGTCAAATTTC
AGAGACATGGTAAAAGAATTATCTGACATTATCCATGAGCAGATATTACAAGAAGACACA
ATGCATTCTCCCTGGATGAGCAACACATTACATGTATTTTGTGCAATTAGTGGTACATCA
AGTGACCGAGGTTATGGTTCCCCAAGATACGCTGAAGTGTGA
Protein Properties
Number of Residues 2073
Molecular Weight 237668.7
Theoretical pI 7.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 11
MAEVRKFTKRLSKPGTAAELRQSVSEAVRGSVVLEKAKVVEPLDYENVIAQRKTQIYSDP
LRDLLMFPMEDISISVIGRQRRTVQSTVPEDAEKRAQSLFVKECIKTYSTDWHVVNYKYE
DFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNST
ITVTMKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKGCIYLDACIDVVQCPKMRRHAF
ELKMLDKYSHYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKA
ENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFE
EKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINLALFDVKNNCKISADFHVDLN
PPSVREMLWGSSTQLASDGSPKGSSPESYIHGIAESQLRYIQQGIFSVTNPHPEIFLVAR
IEKVLQGNITHCAEPYIKNSDPVKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQG
SLDLDGRFSPLYKQDSSKLSSEDILKLLSEYKKPEKTKLQIIPGQLNITVECVPVDLSNC
ITSSYVPLKPFEKNCQNITVEVEEFVPEMTKYCYPFTIYKNHLYVYPLQLKYDSQKTFAK
ARNIAVCVEFRDSDESDASALKCIYGKPAGSVFTTNAYAVVSHHNQNPEFYDEIKIELPI
HLHQKHHLLFTFYHVSCEINTKGTTKKQDTVETPVGFAWVPLLKDGRIITFEQQLPVSAN
LPPGYLNLNDAESRRQCNVDIKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQLIQS
GSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVLTNMTHEDDVPINCTMVLLHIV
SKCHEEGLDSYLRSFIKYSFRPEKPSAPQAQLIHETLATTMIAILKQSADFLSINKLLKY
SWFFFEIIAKSMATYLLEENKIKLPRGQRFPETYHHVLHSLLLAIIPHVTIRYAEIPDES
RNVNYSLASFLKRCLTLMDRGFIFNLINDYISGFSPKDPKVLAEYKFEFLQTICNHEHYI
PLNLPMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYEIRYTAISV
IKNLLIKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRD
EFPCGFTSPANRGSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGNTGENTR
QSSTRSSVSQYNRLDQYEIRSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVC
LFHFRYMGKRNIARVHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLN
HSSTTTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKTQLLNNDGHNPLMKKVFDIH
LAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNE
ASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFANS
DRPMKATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKT
WLDSMAKIHVKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNIDEEGAMK
EDAGMMDVHYSEEVLLELLEQCVDGLWKAERYEIISEISKLIVPIYEKRREFEKLTQVYR
TLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLV
KLYGEKFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNI
SRFVFEAPYTLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINCEQQINLKPIDVATD
EIKDKTAELQKLCSSTDVDMIQLQLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKV
SELKDMFRKFIQACSIALELNERLIKEDQVEYHEGLKSNFRDMVKELSDIIHEQILQEDT
MHSPWMSNTLHVFCAISGTSSDRGYGSPRYAEV
GenBank ID Protein 145699123
UniProtKB/Swiss-Prot ID Q5JSL3
UniProtKB/Swiss-Prot Entry Name DOC11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_144658.3
GeneCard ID DOCK11
GenAtlas ID DOCK11
HGNC ID HGNC:23483
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  5. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  6. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  7. Lin Q, Yang W, Baird D, Feng Q, Cerione RA: Identification of a DOCK180-related guanine nucleotide exchange factor that is capable of mediating a positive feedback activation of Cdc42. J Biol Chem. 2006 Nov 17;281(46):35253-62. Epub 2006 Sep 12. [PubMed:16968698 ]