You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08355
Secondary Accession Numbers
  • 14067
Name Dedicator of cytokinesis protein 4
Synonyms Not Available
Gene Name DOCK4
Protein Type Unknown
Biological Properties
General Function Involved in guanyl-nucleotide exchange factor activity
Specific Function Involved in regulation of adherens junction between cells. Functions as a guanine nucleotide exchange factor (GEF), which activates Rap1 small GTPase by exchanging bound GDP for free GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
enzyme regulator activity
protein binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location
  1. Endomembrane system
  2. Peripheral membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7q31.1
SNPs DOCK4
Gene Sequence
>5901 bp
ATGTGGATACCTACGGAGCACGAGAAATACGGCGTGGTTATTGCCAGTTTCCGAGGAACC
GTTCCATATGGCCTGTCATTGGAAATTGGAGATACAGTTCAGATCCTGGAGAAGTGTGAT
GGCTGGTACAGAGGATTTGCCTTAAAAAACCCAAATATCAAGGGTATATTTCCTTCCAGC
TACGTTCACTTGAAAAATGCCTGTGTAAAGAACAAAGGACAATTTGAAATGGTTATTCCC
ACTGAAGACTCTGTTATCACAGAAATGACATCAACATTAAGAGACTGGGGAACCATGTGG
AAACAACTCTATGTGCGTAATGAAGGCGATCTCTTCCACCGGCTGTGGCACATCATGAAT
GAAATCCTGGACCTGAGGCGGCAGGTGCTGGTGGGCCACCTCACCCACGACCGGATGAAG
GACGTGAAGCGCCACATTACTGCCCGGCTTGACTGGGGCAATGAACAACTGGGACTGGAC
CTGGTGCCTAGGAAAGAGTACGCAATGGTGGATCCGGAAGACATCAGCATTACTGAGCTC
TACCGATTGATGGAACATCGACATCGGAAGAAAGACACCCCGGTGCAGGCCAGCAGTCAC
CACCTCTTTGTCCAGATGAAGAGCCTCATGTGTTCCAACCTGGGAGAGGAGCTGGAGGTC
ATCTTCTCACTCTTTGACAGTAAAGAGAACCGGCCAATCAGTGAGAGATTTTTCTTGAGG
CTGAATAGAAACGGGCTTCCCAAAGCCCCTGATAAACCGGAACGACATTGCTCCCTCTTT
GTGGATTTGGGCAGCAGTGAGCTAAGAAAGGACATTTATATCACCGTGCACATTATCCGA
ATCGGTCGAATGGGAGCAGGAGAAAAAAAGAATGCCTGTAGTGTCCAGTACCGACGACCC
TTTGGCTGTGCAGTTCTTAGCATCGCTGACCTGCTAACAGGAGAGACAAAGGATGACCTC
ATTCTGAAAGTATACATGTGTAACACAGAGAGTGAGTGGTACCAAATCCATGAGAACATC
ATCAAAAAGCTGAATGCACGTTATAACTTGACTGGCTCCAATGCAGGTTTAGCAGTTTCC
TTACAGCTATTGCACGGAGACATTGAACAAATCAGAAGGGAATATTCATCAGTATTTTCT
CATGGAGTATCCATAACAAGGAAGCTGGGATTTTCAAATATTATTATGCCTGGTGAAATG
AGGAATGATTTATATATCACTATTGAAAGGGGAGAATTTGAGAAAGGAGGGAAGAGCGTG
GCCAGAAATGTGGAAGTTACGATGTTCATTGTAGACAGTAGTGGCCAAACCCTGAAGGAT
TTTATCTCCTTCGGCTCTGGGGAGCCACCAGCCAGTGAGTACCACTCCTTTGTGCTTTAC
CATAACAACAGTCCCAGGTGGTCTGAACTGCTGAAACTTCCCATTCCTGTGGATAAATTC
CGGGGTGCACACATCCGCTTCGAGTTTCGGCATTGTTCCACAAAGGAGAAAGGAGAGAAG
AAGTTGTTTGGGTTTTCTTTTGTCCCTCTGATGCAAGAAGATGGTAGGACTCTTCCAGAT
GGCACTCATGAGCTCATCGTGCATAAGTGTGAAGAAAACACAAATCTTCAGGATACTACC
CGCTACCTCAAACTTCCCTTTTCCAAGGGCATTTTCCTTGGGAATAATAATCAAGCCATG
AAGGCCACAAAGGAGTCCTTTTGTATTACATCTTTTCTCTGTTCCACAAAACTCACACAA
AATGGTGATATGCTTGATCTTTTGAAATGGAGAACCCACCCAGACAAGATCACTGGCTGT
CTCTCTAAATTAAAAGAAATTGATGGCTCAGAGATAGTAAAGTTTCTGCAGGATACACTG
GATACCTTATTTGGAATTTTAGATGAAAATTCCCAAAAATATGGGTCTAAAGTGTTTGAT
TCTTTGGTTCACATAATAAATTTGCTGCAAGATAGCAAATTTCATCATTTTAAACCTGTA
ATGGACACTTACATTGAGAGTCATTTTGCTGGGGCACTTGCATACAGAGATCTCATCAAA
GTGCTCAAATGGTACGTGGACCGGATCACAGAAGCAGAGCGGCAAGAGCATATCCAGGAG
GTGCTGAAGGCACAAGAATACATTTTTAAGTATATAGTTCAATCTCGAAGGCTGTTTTCC
CTTGCCACTGGTGGGCAAAACGAAGAGGAGTTCCGCTGCTGCATTCAGGAGCTTCTCATG
TCAGTCCGTTTCTTTCTTTCGCAAGAGAGCAAAGGGTCTGGAGCATTATCTCAGTCACAG
GCTGTGTTTCTGAGCTCTTTCCCTGCCGTGTACTCAGAACTGTTGAAGCTCTTTGATGTC
CGGGAAGTAGCCAACTTGGTCCAGGACACCCTGGGCAGTCTGCCGACCATCCTGCATGTG
GATGATTCCCTGCAGGCCATCAAACTGCAGTGCATTGGCAAAACCGTGGAAAGCCAGCTT
TATACCAACCCAGATTCCCGATACATTCTTCTGCCTGTCGTGTTACATCACCTCCACATT
CACTTGCAAGAACAGAAGGACCTGATCATGTGTGCACGTATCCTTAGCAACGTATTTTGT
CTTATCAAGAAAAATAGCTCAGAAAAATCTGTGCTGGAGGAAATAGATGTGATAGTGGCC
AGCTTGCTGGATATTCTGCTGAGGACCATATTGGAGATCACCAGCCGACCTCAGCCATCC
AGCTCAGCAATGCGGTTCCAGTTCCAGGATGTCACTGGGGAGTTTGTTGCTTGTCTCCTG
TCCCTATTACGACAAATGACAGATAGACATTATCAACAGCTTCTTGATAGTTTTAATACA
AAGGAAGAACTAAGGGATTTCCTGCTGCAGATATTTACTGTGTTCCGAATATTGATACGC
CCGGAGATGTTTCCAAAGGACTGGACTGTTATGCGCTTGGTTGCTAACAATGTTATTATT
ACAACAGTTCTATACCTCTCAGATGCACTTCGTAAGAACTTCTTAAATGAAAACTTTGAT
TATAAGATCTGGGATTCCTACTTTTACCTCGCAGTCATTTTTATAAACCAGTTGTGTCTG
CAGTTGGAGATGTTCACACCTTCCAAGAAGAAAAAGGTGTTAGAAAAGTATGGTGACATG
CGGGTAACAATGGGTTGTGAAATTTTCAGCATGTGGCAAAACCTAGGAGAGCACAAGCTT
CATTTTATCCCTGCCCTGATTGGCCCCTTCCTAGAAGTGACCTTGATACCCCAGCCAGAT
CTTCGGAATGTCATGATTCCAATTTTTCATGATATGATGGACTGGGAGCAGAGGCGGAGT
GGCAACTTTAAACAGGTGGAAGCCAAGCTAATTGACAAACTGGATAGCCTGATGTCAGAA
GGCAAAGGTGACGAAACATACCGCGAGCTCTTCAACAGTATTCTACTAAAGAAAATTGAG
CGGGAAACATGGCGGGAAAGTGGCGTTTCATTAATTGCTACTGTAACTCGTCTAATGGAG
AGGTTGTTAGATTACAGGGACTGCATGAAAATGGGAGAGGTAGATGGCAAAAAGATTGGC
TGCACAGTTAGCCTTCTGAACTTCTATAAGACTGAACTGAACAAGGAGGAGATGTATATA
CGCTACATTCACAAACTCTATGATCTGCATCTCAAAGCACAGAACTTTACAGAAGCTGCA
TATACCCTCCTCTTATATGACGAGCTACTGGAATGGTCTGATCGGCCCCTCAGGGAGTTC
CTGACCTACCCCATGCAAACAGAATGGCAGCGCAAAGAGCACCTGCACCTCACCATCATC
CAGAACTTTGACAGAGGCAAATGTTGGGAGAATGGCATTATCTTGTGCCGGAAGATTGCA
GAGCAGTATGAGAGTTATTATGACTACAGAAACCTGAGCAAGATGCGGATGATGGAAGCC
TCTTTGTATGACAAAATTATGGACCAGCAACGTCTTGAACCAGAGTTCTTCAGAGTTGGA
TTTTATGGAAAAAAATTTCCATTTTTCTTAAGAAATAAGGAGTTTGTGTGTCGAGGGCAT
GACTACGAGAGGCTGGAAGCCTTCCAACAGAGAATGCTGAACGAGTTCCCCCATGCCATC
GCCATGCAGCACGCCAACCAGCCCGATGAGACCATCTTCCAGGCAGAAGCTCAGTATTTG
CAGATATATGCTGTGACTCCCATTCCAGAGAGCCAGGAGGTCCTGCAGAGAGAGGGTGTT
CCGGACAACATCAAAAGCTTCTATAAAGTGAATCACATCTGGAAATTCCGCTATGACCGA
CCATTTCACAAAGGCACAAAAGATAAAGAGAATGAATTCAAGAGTCTCTGGGTGGAGAGA
ACGTCATTATACTTGGTGCAGAGTTTGCCTGGCATCTCTCGCTGGTTTGAAGTGGAAAAG
CGTGAAGTGGTAGAAATGAGTCCTCTGGAAAATGCAATTGAAGTGCTAGAAAATAAGAAT
CAGCAGCTGAAGACTCTGATTAGTCAGTGTCAGACAAGACAGATGCAGAATATTAATCCC
CTGACTATGTGCCTGAATGGAGTTATAGATGCTGCAGTTAATGGTGGCGTTTCCAGGTAT
CAAGAGGCATTCTTTGTCAAAGAATATATCTTAAGTCACCCTGAAGATGGGGAGAAAATT
GCACGATTAAGAGAGCTGATGCTTGAGCAGGCACAGATTCTGGAATTTGGTTTGGCCGTG
CATGAGAAGTTTGTACCTCAAGATATGAGACCCCTTCACAAAAAGCTGGTTGACCAATTC
TTTGTGATGAAGTCGAGCTTAGGGATACAGGAGTTCTCTGCTTGTATGCAAGCCAGTCCT
GTCCATTTTCCTAATGGAAGCCCTCGTGTGTGTAGAAACTCAGCACCTGCTTCTGTGAGC
CCAGATGGTACCAGGGTAATTCCTAGACGCAGCCCGTTAAGTTACCCAGCTGTCAACCGA
TATTCTTCCTCCTCACTGTCCTCACAAGCTTCTGCTGAAGTAAGCAATATTACAGGGCAA
TCAGAAAGCTCTGATGAAGTCTTTAACATGCAGCCAAGTCCATCTACCTCAAGCTTGAGT
TCTACTCACTCGGCTTCACCTAATGTGACAAGTTCTGCTCCATCGAGTGCCAGAGCTTCT
CCTTTGTTGTCTGACAAACACAAACATTCCCGAGAAAACTCTTGCCTGTCACCAAGAGAG
AGACCATGCAGTGCCATCTATCCAACACCTGTGGAGCCTTCGCAGAGGATGCTGTTTAAT
CATATTGGAGACGGGGCCTTGCCACGCAGTGACCCAAATCTCTCTGCACCTGAAAAAGCT
GTGAACCCCACCCCTAGCAGCTGGAGCCTGGACAGTGGGAAGGAAGCCAAGAACATGTCG
GATAGTGGGAAACTTATCTCTCCCCCTGTCCCTCCAAGACCCACACAGACTGCTTCACCA
GCAAGACACACGACATCAGTATCCCCCTCGCCTGCCGGGCGATCTCCATTGAAGGGCTCT
GTGCAGTCTTTCACCCCCTCTCCAGTGGAGTACCACTCGCCAGGACTCATCTCCAACTCC
CCTGTCTTGTCGGGCAGCTACAGCAGTGGGATTTCTTCTCTCAGCCGGTGCAGCACGTCG
GAAACCTCAGGCTTTGAAAATCAGGTGAATGAACAGTCGGCCCCCCTGCCGGTGCCAGTG
CCGGTGCCCGTGCCGAGCTACGGCGGGGAGGAGCCAGTGCGCAAGGAGAGCAAGACTCCG
CCCCCGTACAGCGTCTACGAGCGGACTCTGCGGCGCCCCGTCCCGCTACCTCACAGCCTC
TCCATCCCCGTCACGTCGGAGCCGCCCGCGCTGCCCCCCAAGCCTCTGGCAGCGCGATCC
AGCCACCTGGAGAATGGGGCCCGGAGGACTGACCCCGGCCCGCGGCCCAGGCCCCTGCCC
CGCAAGGTCTCTCAGTTATAA
Protein Properties
Number of Residues 1966
Molecular Weight 225204.3
Theoretical pI 7.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 4
MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSS
YVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMN
EILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
FGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV
ARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKF
RGAHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTT
RYLKLPFSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGC
LSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPS
SSAMRFQFQDVTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIR
PEMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCL
QLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPALIGPFLEVTLIPQPD
LRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIE
RETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYI
RYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTII
QNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVG
FYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYL
QIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVER
TSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINP
LTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKIARLRELMLEQAQILEFGLAV
HEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPRVCRNSAPASVS
PDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLS
STHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRMLFN
HIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASP
ARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTS
ETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSL
SIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
GenBank ID Protein 92091572
UniProtKB/Swiss-Prot ID Q8N1I0
UniProtKB/Swiss-Prot Entry Name DOCK4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014705.3
GeneCard ID DOCK4
GenAtlas ID DOCK4
HGNC ID HGNC:19192
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  5. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  6. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  7. Cote JF, Vuori K: Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity. J Cell Sci. 2002 Dec 15;115(Pt 24):4901-13. [PubMed:12432077 ]
  8. Yajnik V, Paulding C, Sordella R, McClatchey AI, Saito M, Wahrer DC, Reynolds P, Bell DW, Lake R, van den Heuvel S, Settleman J, Haber DA: DOCK4, a GTPase activator, is disrupted during tumorigenesis. Cell. 2003 Mar 7;112(5):673-84. [PubMed:12628187 ]