You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08359
Secondary Accession Numbers
  • 14071
Name Dedicator of cytokinesis protein 8
Synonyms Not Available
Gene Name DOCK8
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
enzyme regulator activity
protein binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9p24.3
SNPs DOCK8
Gene Sequence
>6300 bp
ATGGCCACTCTGCCGAGCGCAGAGCGCCGCGCGTTCGCGCTCAAGATCAACAGGTATTCT
TCAGTGGAAATAAGGAAACAGTTTACTCTCCCACCAAACCTTGGCCAGTACCATCGACAG
AGCATAAGTACCTCTGGCTTCCCCTCTCTTCAACTACCTCAGTTTTATGACCCTGTGGAG
CCAGTGGACTTTGAAGGACTTCTGATGACACACCTGAACAGCCTGGATGTGCAGCTTGCC
CAGGAGCTCGGGGACTTCACTGATGACGACTTGGACGTGGTGTTCACGACAAAGGAATGT
AGGACTTTGCAGCCCTCTTTGCCGGAGGAAGGGGTTGAACTGGACCCTCATGTCAGGGAC
TGTGTTCAGACCTACATCCGTGAGTGGCTAATCGTGAACCGGAAAAACCAAGGAAGTCCA
GAAATCTGTGGCTTTAAAAAGACTGGATCTCGAAAAGATTTTCACAAGACGCTTCCGAAA
CAGACGTTTGAGTCGGAAACCTTGGAGTGCAGTGAACCCGCTGCTCAGGCAGGCCCCCGC
CACTTAAACGTGCTGTGCGACGTGTCTGGGAAAGGCCCCGTCACTGCCTGTGACTTTGAC
CTCCGCAGCCTGCAGCCTGACAAGCGGCTAGAAAACCTCCTGCAGCAAGTGAGTGCCGAG
GACTTTGAGAAGCAGAACGAGGAGGCCCGGAGGACCAATAGGCAGGCCGAGCTCTTTGCC
CTTTACCCATCAGTGGACGAGGAGGATGCTGTGGAAATACGTCCAGTACCAGAATGTCCC
AAGGAACACCTGGGCAACAGAATATTGGTCAAGTTGCTGACCTTGAAGTTCGAGATTGAA
ATTGAGCCCCTGTTTGCCAGCATTGCCCTCTACGATGTTAAAGAAAGGAAAAAGATCTCA
GAAAATTTTCACTGTGACCTGAACTCTGACCAGTTCAAAGGATTTCTGCGAGCTCACACG
CCTTCAGTGGCCGCATCAAGTCAGGCGAGATCTGCAGTCTTCTCAGTCACCTACCCGTCC
TCAGACATCTACCTGGTAGTCAAGATTGAAAAAGTCCTGCAGCAGGGAGAGATTGGAGAC
TGTGCAGAGCCCTACACGGTTATCAAAGAAAGTGATGGTGGAAAGAGTAAAGAAAAGATT
GAAAAACTAAAACTCCAAGCTGAATCCTTCTGCCAGCGTTTGGGGAAATACCGGATGCCC
TTTGCCTGGGCACCCATAAGCTTATCAAGCTTCTTCAATGTCTCCACCCTTGAGAGGGAG
GTAACTGATGTGGACTCTGTGGTTGGGAGAAGCTCAGTGGGTGAACGGAGGACATTGGCC
CAATCTAGAAGGCTTTCTGAAAGAGCCCTCTCCTTGGAGGAAAATGGGGTTGGATCCAAC
TTCAAAACCTCCACTCTGAGCGTTAGCAGCTTTTTCAAGCAGGAAGGAGATCGCCTTAGC
GATGAAGACTTATTCAAGTTTTTAGCTGACTACAAAAGATCATCATCCTTACAGAGACGA
GTCAAGTCAATTCCAGGCTTGCTAAGACTGGAGATTTCTACAGCTCCAGAGATCATCAAT
TGCTGTCTGACTCCTGAAATGCTGCCCGTGAAACCCTTTCCTGAAAACCGGACACGCCCG
CACAAAGAGATTTTGGAATTTCCAACACGAGAAGTATATGTCCCTCACACTGTGTACAGA
AACCTTCTCTATGTCTACCCACAGAGGCTGAACTTTGTAAACAAACTAGCATCAGCCCGG
AACATTACAATAAAGATCCAGTTTATGTGTGGAGAAGATGCTAGCAATGCGATGCCGGTC
ATCTTTGGAAAGTCCAGCGGGCCTGAATTTCTGCAGGAAGTGTACACAGCTGTTACATAC
CATAATAAGTCTCCTGACTTTTATGAAGAAGTGAAAATTAAGCTCCCCGCTAAGCTCACA
GTAAATCACCACCTCCTGTTCACCTTCTACCATATCAGCTGTCAGCAGAAGCAAGGAGCC
TCCGTGGAAACTCTCCTGGGATATTCATGGCTGCCAATTCTCTTAAATGAACGTCTTCAA
ACTGGATCCTACTGTCTCCCAGTTGCCTTGGAAAAATTGCCACCCAACTACTCCATGCAT
TCTGCTGAGAAAGTCCCATTACAGAATCCTCCCATTAAGTGGGCTGAAGGACATAAGGGA
GTATTTAATATTGAAGTGCAAGCTGTTTCTTCTGTACACACCCAGGACAACCACCTGGAG
AAGTTCTTCACCCTCTGCCACTCCCTGGAGAGCCAGGTGACCTTCCCCATCCGCGTGCTG
GATCAGAAAATCAGCGAGATGGCGCTGGAGCATGAGCTGAAGCTCAGCATCATCTGCCTC
AACTCCTCCCGCCTGGAGCCGCTCGTGCTCTTCCTGCACCTGGTGCTGGACAAGCTCTTC
CAGCTGTCCGTGCAGCCCATGGTCATCGCTGGCCAGACAGCCAACTTCTCCCAGTTTGCC
TTCGAGTCCGTGGTGGCCATCGCCAACAGTCTGCACAACAGCAAGGACCTGAGCAAGGAC
CAGCATGGGAGGAACTGCCTGCTGGCTTCCTACGTGCACTACGTCTTCCGCCTGCCAGAG
GTGCAAAGGGATGTGCCCAAGTCAGGCGCTCCCACTGCCCTCCTAGACCCTCGGAGCTAC
CACACGTATGGCCGCACATCAGCTGCTGCTGTGAGTTCAAAGCTGCTGCAGGCCCGGGTG
ATGAGCAGCAGTAACCCAGACCTCGCGGGGACACACTCCGCAGCAGACGAGGAAGTGAAG
AACATCATGTCTTCAAAGATCGCCGATCGCAACTGCAGCCGAATGTCTTACTATTGCTCT
GGCAGTAGTGATGCTCCAAGTTCACCTGCAGCCCCAAGGCCAGCCAGCAAAAAGCATTTC
CATGAGGAGCTTGCCCTTCAGATGGTGGTCAGCACCGGAATGGTGAGAGAAACAGTCTTC
AAGTATGCCTGGTTCTTCTTTGAGCTTCTGGTGAAAAGCATGGCCCAGCACGTACATAAC
ATGGACAAACGGGACAGTTTTCGGAGGACTCGTTTTTCTGACCGTTTCATGGATGACATA
ACTACTATTGTTAATGTGGTCACCTCGGAAATTGCAGCCCTTTTAGTAAAACCACAGAAG
GAAAATGAACAGGCGGAAAAGATGAACATCAGCCTGGCTTTCTTCTTGTATGACCTTCTC
TCCCTCATGGATCGGGGCTTTGTGTTTAACCTCATCAGACATTATTGCAGCCAGCTGTCA
GCCAAGCTCAGTAACCTTCCAACGCTCATTTCCATGAGGCTAGAGTTCCTGAGAATCCTC
TGTAGCCATGAGCATTACCTCAATCTGAACCTTTTTTTTATGAATGCTGATACTGCTCCA
ACATCTCCTTGTCCTTCCATATCTTCCCAGAACTCAAGCTCCTGCTCCAGCTTCCAGGAC
CAGAAGATCGCCAGCATGTTCGATCTGACTTCCGAGTACCGCCAGCAGCACTTCCTCACC
GGGCTCCTCTTCACAGAACTGGCTGCTGCCCTGGATGCCGAAGGGGAAGGAATCAGCAAA
GTACAAAGGAAAGCTGTCAGTGCAATTCACAGCCTGCTAAGTTCTCACGACCTGGACCCA
CGCTGTGTCAAACCAGAGGTGAAGGTCAAAATCGCCGCCCTTTACCTACCTTTAGTTGGC
ATCATTTTGGATGCTTTGCCACAGCTCTGTGACTTTACAGTTGCAGATACTCGCAGATAC
CGCACCAGTGGCTCGGATGAAGAACAAGAAGGAGCCGGTGCCATTAACCAGAATGTGGCT
CTGGCCATAGCAGGGAATAATTTCAATTTGAAAACAAGTGGAATAGTGCTGTCTTCCTTG
CCCTATAAGCAGTACAACATGCTGAACGCGGACACTACTCGCAACCTCATGATCTGCTTC
CTCTGGATCATGAAAAATGCTGATCAGAGCCTCATTAGGAAGTGGATTGCTGACCTGCCA
TCAACGCAGCTCAACAGGATTTTAGATCTACTTTTCATCTGTGTGTTATGTTTTGAGTAT
AAGGGAAAACAGAGTTCTGACAAAGTCAGTACCCAAGTCCTGCAGAAGTCAAGGGATGTC
AAGGCCCGGCTGGAAGAGGCTTTGCTCCGTGGGGAAGGGGCCAGAGGGGAGATGATGCGC
CGCCGGGCTCCAGGGAACGACCGATTTCCAGGCCTAAATGAAAATTTGAGATGGAAGAAA
GAGCAGACACATTGGCGGCAAGCTAATGAGAAGCTAGATAAAACAAAGGCCGAGTTAGAT
CAAGAAGCCTTGATCAGTGGCAATCTGGCTACAGAAGCACATTTAATCATCCTGGATATG
CAGGAAAACATTATCCAGGCGAGCTCGGCTCTGGACTGTAAAGACAGCCTGCTGGGAGGT
GTTCTGAGGGTGCTGGTGAATTCTCTGAACTGTGATCAGAGTACCACCTACCTGACTCAC
TGCTTTGCAACACTCCGTGCTCTCATCGCCAAGTTTGGAGACTTACTCTTCGAAGAGGAG
GTGGAACAGTGTTTCGACCTATGTCACCAAGTCCTGCACCACTGCAGCAGCAGCATGGAT
GTCACCCGGAGCCAAGCCTGTGCCACCCTTTACCTCCTCATGAGGTTCAGTTTTGGAGCC
ACCAGTAATTTTGCAAGAGTAAAGATGCAAGTAACCATGTCCCTGGCATCTTTGGTGGGA
AGAGCACCAGACTTTAATGAAGAGCACCTGAGAAGATCCTTGAGGACAATTTTGGCCTAT
TCAGAAGAGGACACAGCCATGCAGATGACTCCTTTTCCCACCCAGGTGGAGGAACTTCTC
TGTAATCTGAATAGCATCTTATATGACACAGTGAAAATGAGGGAATTTCAGGAAGATCCT
GAGATGCTTATGGATCTCATGTACAGAATTGCCAAGAGTTACCAGGCATCTCCTGATCTG
CGGCTGACCTGGCTCCAGAACATGGCAGAGAAACACACCAAGAAGAAGTGCTACACGGAG
GCTGCCATGTGCCTGGTGCACGCCGCTGCGTTAGTGGCTGAGTATCTGAGCATGCTGGAG
GACCACAGCTACCTGCCCGTGGGCAGTGTCAGCTTCCAGAATATTTCTTCCAATGTGCTG
GAGGAGTCTGTGGTCTCTGAGGACACCCTGTCACCTGACGAGGATGGGGTGTGCGCAGGC
CAGTACTTCACCGAGAGTGGCCTGGTAGGCCTCCTGGAGCAGGCCGCGGAGCTCTTCAGC
ACGGGAGGCTTATATGAGACAGTTAATGAGGTCTACAAGCTGGTCATCCCCATCCTAGAA
GCGCATCGAGAATTCCGGAAGCTGACACTCACTCACAGCAAGCTGCAGAGAGCCTTCGAC
AGCATCGTTAACAAGGATCATAAGAGAATGTTTGGAACCTACTTCCGAGTTGGTTTCTTT
GGATCCAAATTTGGGGATTTGGATGAACAGGAGTTTGTCTACAAAGAGCCTGCAATTACC
AAGCTTCCTGAGATCTCACATAGACTAGAGGCATTTTATGGTCAATGTTTTGGTGCAGAA
TTTGTGGAAGTGATTAAAGACTCCACTCCTGTGGACAAAACCAAGTTGGATCCTAACAAG
GCCTACATACAGATCACTTTTGTGGAGCCCTACTTTGATGAGTATGAGATGAAAGACAGG
GTCACATACTTTGAGAAGAATTTCAACCTCCGGAGGTTCATGTACACCACCCCGTTCACC
CTGGAGGGGCGGCCTCGGGGAGAGCTGCATGAGCAGTACAGAAGGAACACAGTCCTGACC
ACTATGCACGCCTTCCCCTACATCAAGACCAGGATCAGCGTCATCCAGAAGGAGGAGTTT
GTTTTGACACCGATTGAAGTTGCCATTGAAGACATGAAGAAGAAGACCCTGCAGTTAGCA
GTTGCCATTAACCAGGAGCCGCCTGATGCAAAGATGCTTCAGATGGTGCTGCAAGGCTCT
GTGGGAGCTACTGTAAATCAGGGACCACTGGAAGTAGCCCAAGTGTTTTTGGCTGAAATT
CCTGCTGATCCAAAACTCTATCGACATCACAACAAGTTGAGGTTATGCTTTAAGGAATTC
ATCATGAGATGTGGTGAAGCTGTAGAGAAAAACAAGCGTCTCATCACGGCAGACCAGAGG
GAATATCAGCAGGAACTCAAAAAGAACTATAACAAGCTAAAAGAGAACCTCAGGCCAATG
ATCGAGCGGAAAATTCCAGAACTGTACAAGCCAATATTCAGAGTTGAGAGTCAAAAGAGG
GACTCCTTCCACAGATCTAGTTTCAGGAAATGTGAAACCCAGTTGTCACAGGGCAGCTAA
Protein Properties
Number of Residues 2099
Molecular Weight 238526.7
Theoretical pI 6.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 8
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVQLAQELGDFTDDDLDVVFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSPEICGFKKTGSRKDFHKTLPKQTFESETLECSEPAAQAGPR
HLNVLCDVSGKGPVTACDFDLRSLQPDKRLENLLQQVSAEDFEKQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVAASSQARSAVFSVTYPSSDIYLVVKIEKVLQQGEIGD
CAEPYTVIKESDGGKSKEKIEKLKLQAESFCQRLGKYRMPFAWAPISLSSFFNVSTLERE
VTDVDSVVGRSSVGERRTLAQSRRLSERALSLEENGVGSNFKTSTLSVSSFFKQEGDRLS
DEDLFKFLADYKRSSSLQRRVKSIPGLLRLEISTAPEIINCCLTPEMLPVKPFPENRTRP
HKEILEFPTREVYVPHTVYRNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPV
IFGKSSGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGA
SVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQNPPIKWAEGHKG
VFNIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISEMALEHELKLSIICL
NSSRLEPLVLFLHLVLDKLFQLSVQPMVIAGQTANFSQFAFESVVAIANSLHNSKDLSKD
QHGRNCLLASYVHYVFRLPEVQRDVPKSGAPTALLDPRSYHTYGRTSAAAVSSKLLQARV
MSSSNPDLAGTHSAADEEVKNIMSSKIADRNCSRMSYYCSGSSDAPSSPAAPRPASKKHF
HEELALQMVVSTGMVRETVFKYAWFFFELLVKSMAQHVHNMDKRDSFRRTRFSDRFMDDI
TTIVNVVTSEIAALLVKPQKENEQAEKMNISLAFFLYDLLSLMDRGFVFNLIRHYCSQLS
AKLSNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAPTSPCPSISSQNSSSCSSFQD
QKIASMFDLTSEYRQQHFLTGLLFTELAAALDAEGEGISKVQRKAVSAIHSLLSSHDLDP
RCVKPEVKVKIAALYLPLVGIILDALPQLCDFTVADTRRYRTSGSDEEQEGAGAINQNVA
LAIAGNNFNLKTSGIVLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQSLIRKWIADLP
STQLNRILDLLFICVLCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMR
RRAPGNDRFPGLNENLRWKKEQTHWRQANEKLDKTKAELDQEALISGNLATEAHLIILDM
QENIIQASSALDCKDSLLGGVLRVLVNSLNCDQSTTYLTHCFATLRALIAKFGDLLFEEE
VEQCFDLCHQVLHHCSSSMDVTRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVG
RAPDFNEEHLRRSLRTILAYSEEDTAMQMTPFPTQVEELLCNLNSILYDTVKMREFQEDP
EMLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKKKCYTEAAMCLVHAAALVAEYLSMLE
DHSYLPVGSVSFQNISSNVLEESVVSEDTLSPDEDGVCAGQYFTESGLVGLLEQAAELFS
TGGLYETVNEVYKLVIPILEAHREFRKLTLTHSKLQRAFDSIVNKDHKRMFGTYFRVGFF
GSKFGDLDEQEFVYKEPAITKLPEISHRLEAFYGQCFGAEFVEVIKDSTPVDKTKLDPNK
AYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTVLT
TMHAFPYIKTRISVIQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGS
VGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQR
EYQQELKKNYNKLKENLRPMIERKIPELYKPIFRVESQKRDSFHRSSFRKCETQLSQGS
GenBank ID Protein 76150613
UniProtKB/Swiss-Prot ID Q8NF50
UniProtKB/Swiss-Prot Entry Name DOCK8_HUMAN
PDB IDs Not Available
GenBank Gene ID AB191037
GeneCard ID DOCK8
GenAtlas ID DOCK8
HGNC ID HGNC:19191
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]
  7. Cote JF, Vuori K: Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity. J Cell Sci. 2002 Dec 15;115(Pt 24):4901-13. [PubMed:12432077 ]
  8. Ottolenghi C, Veitia R, Quintana-Murci L, Torchard D, Scapoli L, Souleyreau-Therville N, Beckmann J, Fellous M, McElreavey K: The region on 9p associated with 46,XY sex reversal contains several transcripts expressed in the urogenital system and a novel doublesex-related domain. Genomics. 2000 Mar 1;64(2):170-8. [PubMed:10729223 ]