You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08360
Secondary Accession Numbers
  • 14072
Name Dedicator of cytokinesis protein 9
Synonyms
  1. Cdc42 guanine nucleotide exchange factor zizimin-1
Gene Name DOCK9
Protein Type Unknown
Biological Properties
General Function Involved in guanyl-nucleotide exchange factor activity
Specific Function Guanine nucleotide-exchange factor (GEF) that activates CDC42 by exchanging bound GDP for free GTP. Overexpression induces filopodia formation
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
enzyme regulator activity
protein binding
gtpase binding
enzyme binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Cellular Location
  1. Endomembrane system (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 13q32.3
SNPs DOCK9
Gene Sequence
>6210 bp
ATGTCGCAGCCGCCGCTGCTCCCCGCCTCGGCGGAGACTCGGAAGTTCACCCGGGCGCTG
AGTAAGCCGGGCACGGCGGCCGAGCTGCGGCAGAGCGTGTCTGAGGTGGTGCGCGGCTCC
GTGCTCCTGGCAAAGCCAAAGCTAATTGAGCCACTCGACTATGAAAATGTCATCGTCCAG
AAGAAGACTCAGATCCTGAACGACTGTTTACGGGAGATGCTGCTCTTCCCTTACGATGAC
TTTCAGACGGCCATCCTGAGACGACAGGGTCGATACATATGCTCAACAGTGCCTGCGAAG
GCGGAAGAGGAAGCACAGAGCTTGTTTGTTACAGAGTGCATCAAAACCTATAACTCTGAC
TGGCATCTTGTGAACTATAAATATGAAGATTACTCAGGAGAGTTTCGACAGCTTCCGAAC
AAAGTGGTCAAGTTGGATAAACTTCCAGTTCATGTCTATGAAGTTGACGAGGAGGTCGAC
AAAGATGAGGATGCTGCCTCCCTTGGTTCCCAGAAGGGTGGGATCACCAAGCATGGCTGG
CTGTACAAAGGCAACATGAACAGTGCCATCAGCGTGACCATGAGGTCATTTAAGAGACGA
TTTTTCCACCTGATTCAACTTGGCGATGGATCCTATAATTTGAATTTTTATAAAGATGAA
AAGATCTCCAAAGAACCAAAAGGATCAATATTTCTGGATTCCTGTATGGGTGTCGTTCAG
AACAACAAAGTCAGGCGTTTTGCTTTTGAGCTCAAGATGCAGGACAAAAGTAGTTATCTC
TTGGCAGCAGACAGTGAAGTGGAAATGGAAGAATGGATCACAATTCTAAATAAGATCCTC
CAGCTCAACTTTGAAGCTGCAATGCAAGAAAAGCGAAATGGCGACTCTCACGAAGATGAT
GAACAAAGCAAATTGGAAGGTTCTGGTTCCGGTTTAGATAGCTACCTGCCGGAACTTGCC
AAGAGTGCAAGAGAAGCAGAAATCAAACTGAAAAGTGAAAGCAGAGTCAAACTTTTTTAT
TTGGACCCAGATGCCCAGAAGCTTGACTTCTCATCAGCTGAGCCAGAAGTGAAGTCATTT
GAAGAGAAGTTTGGAAAAAGGATCCTTGTCAAGTGCAATGATTTATCTTTCAATTTGCAA
TGCTGTGTTGCCGAAAATGAAGAAGGACCCACTACAAATGTTGAACCTTTCTTTGTTACT
CTATCCCTGTTTGACATAAAATACAACCGGAAGATTTCTGCCGATTTCCACGTAGACCTG
AACCATTTCTCAGTGAGGCAAATGCTCGCCACCACGTCCCCGGCGCTGATGAATGGCAGT
GGGCAGAGCCCATCTGTCCTCAAGGGCATCCTTCATGAAGCCGCCATGCAGTATCCGAAG
CAGGGAATATTTTCAGTCACTTGTCCTCATCCAGATATATTTCTTGTGGCCAGAATTGAA
AAAGTCCTTCAGGGGAGCATCACACATTGCGCTGAGCCATATATGAAAAGTTCAGACTCT
TCTAAGGTGGCCCAGAAGGTGCTGAAGAATGCCAAGCAGGCATGCCAAAGACTAGGACAG
TATAGAATGCCATTTGCTTGGGCAGCAAGGACATTGTTTAAGGATGCATCTGGAAATCTT
GACAAAAATGCCAGATTTTCTGCCATCTACAGGCAAGACAGCAATAAGCTATCCAATGAT
GACATGCTCAAGTTACTTGCAGACTTTCGGAAACCTGAGAAGATGGCTAAGCTCCCAGTG
ATTTTAGGCAATCTAGACATTACAATTGATAATGTTTCCTCAGACTTCCCTAATTATGTT
AATTCATCATACATTCCCACAAAACAATTTGAAACCTGCAGTAAAACTCCCATCACGTTT
GAAGTGGAGGAATTTGTGCCCTGCATACCAAAACACACTCAGCCTTACACCATCTACACC
AATCACCTTTACGTTTATCCTAAGTACTTGAAATACGACAGTCAGAAGTCTTTTGCCAAG
GCTAGAAATATTGCGATTTGCATTGAATTCAAAGATTCAGATGAGGAAGACTCTCAGCCC
CTTAAGTGCATTTATGGCAGACCTGGTGGGCCAGTTTTCACAAGAAGCGCCTTTGCTGCA
GTTTTACACCATCACCAAAACCCAGAATTTTATGATGAGATTAAAATAGAGTTGCCCACT
CAGCTGCATGAAAAGCACCACCTGTTGCTCACATTCTTCCATGTCAGCTGTGACAACTCA
AGTAAAGGAAGCACGAAGAAGAGGGATGTCGTTGAAACCCAAGTTGGCTACTCCTGGCTT
CCCCTCCTGAAAGACGGAAGGGTGGTGACAAGCGAGCAGCACATCCCGGTCTCGGCGAAC
CTTCCTTCGGGCTATCTTGGCTACCAGGAGCTTGGGATGGGCAGGCATTATGGTCCGGAA
ATTAAATGGGTAGATGGAGGCAAGCCACTGCTGAAAATTTCCACTCATCTGGTTTCTACA
GTGTATACTCAGGATCAGCATTTACATAATTTTTTCCAGTACTGTCAGAAAACCGAATCT
GGAGCCCAAGCCTTAGGAAACGAACTTGTAAAGTACCTTAAGAGTCTGCATGCGATGGAA
GGCCACGTGATGATCGCCTTCTTGCCCACTATCCTAAACCAGCTGTTCCGAGTCCTCACC
AGAGCCACACAGGAAGAAGTCGCGGTTAACGTGACTCGGGTCATTATTCATGTGGTTGCC
CAGTGCCATGAGGAAGGATTGGAGAGCCACTTGAGGTCATATGTTAAGTACGCGTATAAG
GCTGAGCCATATGTTGCCTCTGAATACAAGACAGTGCATGAAGAACTGACCAAATCCATG
ACCACGATTCTCAAGCCTTCTGCCGATTTCCTCACCAGCAACAAACTACTGAAGTACTCA
TGGTTTTTCTTTGATGTACTGATCAAATCTATGGCTCAGCATTTGATAGAGAACTCCAAA
GTTAAGTTGCTGCGAAACCAGAGATTTCCTGCATCCTATCATCATGCAGTGGAAACCGTT
GTAAATATGCTGATGCCACACATCACTCAGAAGTTTCGAGATAATCCAGAGGCATCTAAG
AACGCGAATCATAGCCTTGCTGTCTTCATCAAGAGATGTTTCACCTTCATGGACAGGGGC
TTTGTCTTCAAGCAGATCAACAACTACATTAGCTGTTTTGCTCCTGGAGACCCAAAGACC
CTCTTTGAATACAAGTTTGAATTTCTCCGTGTAGTGTGCAACCATGAACATTATATTCCG
TTGAACTTACCAATGCCATTTGGAAAAGGCAGGATTCAAAGATACCAAGACCTCCAGCTT
GACTACTCATTAACAGATGAGTTCTGCAGAAACCACTTCTTGGTGGGACTGTTACTGAGG
GAGGTGGGGACAGCCCTCCAGGAGTTCCGGGAGGTCCGTCTGATCGCCATCAGTGTGCTC
AAGAACCTGCTGATAAAGCATTCTTTTGATGACAGATATGCTTCAAGGAGCCATCAGGCA
AGGATAGCCACCCTCTACCTGCCTCTGTTTGGTCTGCTGATTGAAAACGTCCAGCGGATC
AATGTGAGGGATGTGTCACCCTTCCCTGTGAACGCGGGCATGACTGTGAAGGATGAATCC
CTGGCTCTACCAGCTGTGAATCCGCTGGTGACGCCGCAGAAGGGAAGCACCCTGGACAAC
AGCCTGCACAAGGACCTGCTGGGCGCCATCTCCGGCATTGCTTCTCCATATACAACCTCA
ACTCCAAACATCAACAGTGTGAGAAATGCTGATTCGAGAGGATCTCTCATAAGCACAGAT
TCGGGTAACAGCCTTCCAGAAAGGAATAGTGAGAAGAGCAATTCCCTGGATAAGCACCAA
CAAAGTAGCACATTGGGAAATTCCGTGGTTCGCTGTGATAAACTTGACCAGTCTGAGATT
AAGAGCCTACTGATGTGTTTCCTCTACATCTTAAAGAGCATGTCTGATGATGCTTTGTTT
ACATATTGGAACAAGGCTTCAACATCTGAACTTATGGATTTTTTTACAATATCTGAAGTC
TGCCTGCACCAGTTCCAGTACATGGGGAAGCGATACATAGCCAGAACAGGAATGATGCAT
GCCAGATTGCAGCAGCTGGGCAGCCTGGATAACTCTCTCACTTTTAACCACAGCTATGGC
CACTCGGACGCAGATGTTCTGCACCAGTCATTACTTGAAGCCAACATTGCTACTGAGGTT
TGCCTGACAGCTCTGGACACGCTTTCTCTATTTACATTGGCGTTTAAGAACCAGCTCCTG
GCCGACCATGGACATAATCCTCTCATGAAAAAAGTTTTTGATGTCTACCTGTGTTTTCTT
CAAAAACATCAGTCTGAAACGGCTTTAAAAAATGTCTTCACTGCCTTAAGGTCCTTAATT
TATAAGTTTCCCTCAACATTCTATGAAGGGAGAGCGGACATGTGTGCGGCTCTGTGTTAC
GAGATTCTCAAGTGCTGTAACTCCAAGCTGAGCTCCATCAGGACGGAGGCCTCCCAGCTG
CTCTACTTCCTGATGAGGAACAACTTTGATTACACTGGAAAGAAGTCCTTTGTCCGGACA
CATTTGCAAGTCATCATATCTGTCAGCCAGCTGATAGCAGACGTTGTTGGCATTGGGGGA
ACCAGATTCCAGCAGTCCCTGTCCATCATCAACAACTGTGCCAACAGTGACCGGCTTATT
AAGCACACCAGCTTCTCCTCTGATGTGAAGGACTTAACCAAAAGGATACGCACGGTGCTA
ATGGCCACCGCCCAGATGAAGGAGCATGAGAACGACCCAGAGATGCTGGTGGACCTCCAG
TACAGCCTGGCCAAATCCTATGCCAGCACGCCCGAGCTCAGGAAGACGTGGCTCGACAGC
ATGGCCAGGATCCATGTCAAAAATGGCGATCTCTCAGAGGCAGCAATGTGCTATGTCCAC
GTAACAGCCCTAGTGGCAGAATATCTCACACGGAAAGAAGCAGTCCAGTGGGAGCCGCCC
CTTCTCCCCCACAGCCATAGCGCCTGCCTGAGGAGGAGCCGGGGAGGCGTGTTTAGACAA
GGATGCACCGCCTTCAGGGTCATTACCCCAAACATCGACGAGGAGGCCTCCATGATGGAA
GACGTGGGGATGCAGGATGTCCATTTCAACGAGGATGTGCTGATGGAGCTCCTTGAGCAG
TGCGCAGATGGACTCTGGAAAGCCGAGCGCTACGAGCTCATCGCCGACATCTACAAACTT
ATCATCCCCATTTATGAGAAGCGGAGGGATTTTGAGAGGCTGGCCCATCTGTATGACACG
CTGCACCGGGCCTACAGCAAAGTGACCGAGGTCATGCACTCGGGCCGCAGGCTTCTGGGG
ACCTACTTCCGGGTAGCCTTCTTCGGGCAGGCAGCGCAATACCAGTTTACAGACAGTGAA
ACAGATGTGGAGGGATTCTTTGAAGATGAAGATGGAAAGGAGTATATTTACAAGGAACCC
AAACTCACACCGCTGTCGGAAATTTCTCAGAGACTCCTTAAACTGTACTCGGATAAATTT
GGTTCTGAAAATGTCAAAATGATACAGGATTCTGGCAAGGTCAACCCTAAGGATCTGGAT
TCTAAGTATGCATACATCCAGGTGACTCACGTCATCCCCTTCTTTGACGAAAAAGAGTTG
CAAGAAAGGAAAACAGAGTTTGAGAGATCCCACAACATCCGCCGCTTCATGTTTGAGATG
CCATTTACGCAGACCGGGAAGAGGCAGGGCGGGGTGGAAGAGCAGTGCAAACGGCGCACC
ATCCTGACAGCCATACACTGCTTCCCTTATGTGAAGAAGCGCATCCCTGTCATGTACCAG
CACCACACTGACCTGAACCCCATCGAGGTGGCCATTGACGAGATGAGTAAGAAGGTGGCG
GAGCTCCGGCAGCTGTGCTCCTCGGCCGAGGTGGACATGATCAAACTGCAGCTCAAACTC
CAGGGCAGCGTGAGTGTTCAGGTCAATGCTGGCCCACTAGCATATGCGCGAGCTTTCTTA
GATGATACAAACACAAAGCGATATCCTGACAATAAAGTGAAGCTGCTTAAGGAAGTTTTC
AGGCAATTTGTGGAAGCTTGCGGTCAAGCCTTAGCGGTAAACGAACGTCTGATTAAAGAA
GACCAGCTCGAGTATCAGGAAGAAATGAAAGCCAACTACAGGGAAATGGCGAAGGAGCTT
TCTGAAATCATGCATGAGCAGCTGGGATGA
Protein Properties
Number of Residues 2069
Molecular Weight 236443.6
Theoretical pI 7.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Dedicator of cytokinesis protein 9
MSQPPLLPASAETRKFTRALSKPGTAAELRQSVSEVVRGSVLLAKPKLIEPLDYENVIVQ
KKTQILNDCLREMLLFPYDDFQTAILRRQGRYICSTVPAKAEEEAQSLFVTECIKTYNSD
WHLVNYKYEDYSGEFRQLPNKVVKLDKLPVHVYEVDEEVDKDEDAASLGSQKGGITKHGW
LYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGSIFLDSCMGVVQ
NNKVRRFAFELKMQDKSSYLLAADSEVEMEEWITILNKILQLNFEAAMQEKRNGDSHEDD
EQSKLEGSGSGLDSYLPELAKSAREAEIKLKSESRVKLFYLDPDAQKLDFSSAEPEVKSF
EEKFGKRILVKCNDLSFNLQCCVAENEEGPTTNVEPFFVTLSLFDIKYNRKISADFHVDL
NHFSVRQMLATTSPALMNGSGQSPSVLKGILHEAAMQYPKQGIFSVTCPHPDIFLVARIE
KVLQGSITHCAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAARTLFKDASGNL
DKNARFSAIYRQDSNKLSNDDMLKLLADFRKPEKMAKLPVILGNLDITIDNVSSDFPNYV
NSSYIPTKQFETCSKTPITFEVEEFVPCIPKHTQPYTIYTNHLYVYPKYLKYDSQKSFAK
ARNIAICIEFKDSDEEDSQPLKCIYGRPGGPVFTRSAFAAVLHHHQNPEFYDEIKIELPT
QLHEKHHLLLTFFHVSCDNSSKGSTKKRDVVETQVGYSWLPLLKDGRVVTSEQHIPVSAN
LPSGYLGYQELGMGRHYGPEIKWVDGGKPLLKISTHLVSTVYTQDQHLHNFFQYCQKTES
GAQALGNELVKYLKSLHAMEGHVMIAFLPTILNQLFRVLTRATQEEVAVNVTRVIIHVVA
QCHEEGLESHLRSYVKYAYKAEPYVASEYKTVHEELTKSMTTILKPSADFLTSNKLLKYS
WFFFDVLIKSMAQHLIENSKVKLLRNQRFPASYHHAVETVVNMLMPHITQKFRDNPEASK
NANHSLAVFIKRCFTFMDRGFVFKQINNYISCFAPGDPKTLFEYKFEFLRVVCNHEHYIP
LNLPMPFGKGRIQRYQDLQLDYSLTDEFCRNHFLVGLLLREVGTALQEFREVRLIAISVL
KNLLIKHSFDDRYASRSHQARIATLYLPLFGLLIENVQRINVRDVSPFPVNAGMTVKDES
LALPAVNPLVTPQKGSTLDNSLHKDLLGAISGIASPYTTSTPNINSVRNADSRGSLISTD
SGNSLPERNSEKSNSLDKHQQSSTLGNSVVRCDKLDQSEIKSLLMCFLYILKSMSDDALF
TYWNKASTSELMDFFTISEVCLHQFQYMGKRYIARTGMMHARLQQLGSLDNSLTFNHSYG
HSDADVLHQSLLEANIATEVCLTALDTLSLFTLAFKNQLLADHGHNPLMKKVFDVYLCFL
QKHQSETALKNVFTALRSLIYKFPSTFYEGRADMCAALCYEILKCCNSKLSSIRTEASQL
LYFLMRNNFDYTGKKSFVRTHLQVIISVSQLIADVVGIGGTRFQQSLSIINNCANSDRLI
KHTSFSSDVKDLTKRIRTVLMATAQMKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDS
MARIHVKNGDLSEAAMCYVHVTALVAEYLTRKEAVQWEPPLLPHSHSACLRRSRGGVFRQ
GCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLWKAERYELIADIYKL
IIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQAAQYQFTDSE
TDVEGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLD
SKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQTGKRQGGVEEQCKRRT
ILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKL
QGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGQALAVNERLIKE
DQLEYQEEMKANYREMAKELSEIMHEQLG
GenBank ID Protein 24308029
UniProtKB/Swiss-Prot ID Q9BZ29
UniProtKB/Swiss-Prot Entry Name DOCK9_HUMAN
PDB IDs
GenBank Gene ID NM_015296.2
GeneCard ID DOCK9
GenAtlas ID DOCK9
HGNC ID HGNC:14132
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  6. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  7. Meller N, Irani-Tehrani M, Kiosses WB, Del Pozo MA, Schwartz MA: Zizimin1, a novel Cdc42 activator, reveals a new GEF domain for Rho proteins. Nat Cell Biol. 2002 Sep;4(9):639-47. [PubMed:12172552 ]
  8. Cote JF, Vuori K: Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity. J Cell Sci. 2002 Dec 15;115(Pt 24):4901-13. [PubMed:12432077 ]