Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08361
Secondary Accession Numbers
  • 14073
Name Developmentally-regulated GTP-binding protein 1
Synonyms
  1. DRG-1
  2. NEDD-3
  3. Neural precursor cell expressed developmentally down-regulated protein 3
Gene Name DRG1
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function May play a role in cell proliferation, differentiation and death
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.2
SNPs DRG1
Gene Sequence
>1104 bp
ATGAGCAGCACCTTAGCTAAGATCGCGGAGATAGAAGCAGAGATGGCTCGGACTCAAAAG
AACAAGGCCACAGCACACCACTTAGGGCTGCTTAAGGCTCGTCTTGCTAAGCTTCGTCGA
GAACTCATTACTCCAAAGGGTGGTGGTGGTGGAGGTCCAGGAGAAGGTTTTGATGTGGCC
AAGACAGGTGATGCTCGAATTGGATTTGTTGGTTTTCCATCTGTGGGGAAGTCAACACTG
CTTAGTAACCTGGCAGGGGTATATTCTGAGGTGGCAGCCTATGAATTCACTACTCTGACC
ACTGTGCCTGGTGTCATCAGATACAAAGGTGCCAAGATCCAGCTCCTGGATCTCCCAGGT
ATCATTGAAGGTGCCAAGGATGGGAAAGGTAGAGGTCGTCAAGTCATTGCAGTGGCCCGA
ACCTGTAACTTGATCTTGATTGTTCTGGATGTCCTGAAACCTTTGGGACATAAGAAGATA
ATTGAAAATGAGCTGGAAGGCTTTGGCATTCGCTTGAACAGCAAACCCCCCAACATTGGC
TTTAAGAAGAAGGACAAGGGAGGCATTAATCTCACAGCCACTTGCCCCCAGAGTGAGCTG
GATGCTGAAACTGTGAAGAGCATTCTGGCTGAATACAAGATTCATAATGCCGATGTGACT
CTACGTAGTGATGCTACGGCTGATGACCTCATTGATGTGGTGGAAGGAAACAGAGTTTAT
ATCCCCTGTATCTATGTGTTAAATAAGATTGACCAAATCTCCATTGAGGAATTGGATATC
ATCTATAAGGTGCCTCACTGTGTACCCATCTCTGCCCATCACCGCTGGAATTTTGATGAC
CTATTGGAAAAGATCTGGGACTATCTGAAACTAGTGAGAATTTACACCAAACCCAAAGGC
CAGTTACCAGATTACACATCCCCAGTGGTGCTTCCTTACTCCAGGACCACAGTGGAGGAT
TTCTGCATGAAGATTCACAAAAATCTTATCAAAGAATTTAAATATGCTCTGGTCTGGGGT
CTCTCTGTGAAACACAATCCTCAGAAAGTGGGTAAAGACCATACGTTGGAGGATGAGGAT
GTCATTCAAATTGTGAAGAAGTGA
Protein Properties
Number of Residues 367
Molecular Weight 40541.8
Theoretical pI 9.31
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Developmentally-regulated GTP-binding protein 1
MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVA
KTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPG
IIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG
FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVY
IPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKG
QLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDED
VIQIVKK
GenBank ID Protein 4218945
UniProtKB/Swiss-Prot ID Q9Y295
UniProtKB/Swiss-Prot Entry Name DRG1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF078103
GeneCard ID DRG1
GenAtlas ID DRG1
HGNC ID HGNC:3029
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  4. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  5. Jakobs A, Himstedt F, Funk M, Korn B, Gaestel M, Niedenthal R: Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation. Nucleic Acids Res. 2007;35(17):e109. Epub 2007 Aug 20. [PubMed:17709345 ]
  6. Zhao XF, Aplan PD: SCL binds the human homologue of DRG in vivo. Biochim Biophys Acta. 1998 Nov 19;1448(1):109-14. [PubMed:9824680 ]
  7. Li B, Trueb B: DRG represents a family of two closely related GTP-binding proteins. Biochim Biophys Acta. 2000 Apr 25;1491(1-3):196-204. [PubMed:10760581 ]
  8. Ishikawa K, Azuma S, Ikawa S, Semba K, Inoue J: Identification of DRG family regulatory proteins (DFRPs): specific regulation of DRG1 and DRG2. Genes Cells. 2005 Feb;10(2):139-50. [PubMed:15676025 ]