You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08362
Secondary Accession Numbers
  • 14074
Name Developmentally-regulated GTP-binding protein 2
Synonyms
  1. DRG-2
Gene Name DRG2
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function May play a role in cell proliferation, differentiation and death
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 17p11.2
SNPs DRG2
Gene Sequence
>1095 bp
ATGGGGATCTTAGAGAAGATCTCGGAGATCGAGAAGGAGATCGCTCGGACACAGAAGAAC
AAGGCCACTGAGTATCATCTGGGCCTGCTGAAAGCTAAGCTCGCCAAGTATCGGGCCCAG
CTCCTGGAACCGTCCAAATCGGCCTCATCCAAAGGAGAGGGCTTTGATGTCATGAAGTCG
GGTGATGCCCGTGTGGCGCTGATTGGATTTCCCTCTGTGGGTAAGTCCACATTCTTGAGT
CTGATGACCTCCACGGCCAGCGAGGCAGCGTCCTATGAGTTCACCACTCTGACGTGTATT
CCTGGGGTCATTGAATACAAAGGTGCCAACATCCAGCTCCTGGACCTTCCTGGAATCATT
GAAGGCGCAGCCCAAGGAAAAGGCCGTGGCCGGCAGGTGATCGCTGTGGCGCGCACGGCT
GACGTCATCATCATGATGCTGGATGCCACCAAGGGAGAGGTGCAGAGGTCTCTGCTGGAG
AAGGAGCTGGAGTCTGTGGGCATCCGCCTCAACAAGCACAAGCCTAACATCTACTTCAAG
CCCAAGAAAGGTGGTGGCATCTCCTTTAACTCGACAGTCACGCTGACCCAGTGCTCGGAA
AAGCTGGTGCAGCTCATCCTGCACGAATACAAGATCTTCAATGCAGAAGTGCTTTTCCGA
GAAGACTGCTCCCCGGACGAGTTCATCGATGTGATCGTGGGCAACCGGGTGTACATGCCC
TGCCTGTATGTTTATAACAAAATCGACCAGATCTCCATGGAAGAGGTGGACCGCCTGGCC
CGAAAACCCAACAGTGTGGTCATCAGCTGCGGCATGAAGCTGAACCTGGACTATCTGCTG
GAGATGCTTTGGGAGTACTTGGCCCTGACCTGCATCTACACCAAGAAGAGAGGACAGAGG
CCAGACTTCACAGACGCCATCATTCTCCGGAAAGGGGCCTCAGTGGAGCACGTGTGCCAC
CGCATCCACCGGTCACTCGCCAGCCAGTTCAAGTACGCCCTGGTGTGGGGCACCAGCACC
AAGTACAGTCCGCAGCGGGTGGGCCTGACCCACACCATGGAGCATGAGGACGTCATCCAG
ATCGTGAAGAAGTAA
Protein Properties
Number of Residues 364
Molecular Weight 40746.1
Theoretical pI 9.2
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Developmentally-regulated GTP-binding protein 2
MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASSKGEGFDVMKS
GDARVALIGFPSVGKSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVIIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFK
PKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMP
CLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEYLALTCIYTKKRGQR
PDFTDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQ
IVKK
GenBank ID Protein 189066615
UniProtKB/Swiss-Prot ID P55039
UniProtKB/Swiss-Prot Entry Name DRG2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK313362
GeneCard ID DRG2
GenAtlas ID DRG2
HGNC ID HGNC:3030
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Schenker T, Lach C, Kessler B, Calderara S, Trueb B: A novel GTP-binding protein which is selectively repressed in SV40 transformed fibroblasts. J Biol Chem. 1994 Oct 14;269(41):25447-53. [PubMed:7929244 ]