Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08365
Secondary Accession Numbers
  • 14077
Name Dynamin-3
Synonyms
  1. Dynamin, testicular
  2. T-dynamin
Gene Name DNM3
Protein Type Unknown
Biological Properties
General Function Involved in GTP binding
Specific Function Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes, in particular endocytosis (By similarity).
Pathways
  • Bacterial invasion of epithelial cells
  • Endocrine and other factor-regulated calcium reabsorption
  • Endocytosis
  • Fc gamma R-mediated phagocytosis
  • Synaptic vesicle cycle
Reactions
Guanosine triphosphate + Water → Guanosine diphosphate + Phosphate details
GO Classification
Biological Process
synapse assembly
endocytosis
filopodium assembly
Cellular Component
mitochondrion
perinuclear region of cytoplasm
postsynaptic density
microtubule
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Molecular Function
GTPase activity
phospholipid binding
GTP binding
Cellular Location
  1. Cytoplasm
  2. Cytoplasm (Potential)
  3. cytoskeleton (Potential)
Gene Properties
Chromosome Location 1
Locus 1q24.3
SNPs DNM3
Gene Sequence
>2580 bp
ATGGGGAACCGGGAGATGGAGGAGCTGATCCCGCTGGTGAACCGTCTGCAGGACGCGTTT
TCGGCGCTGGGACAGAGCTGCCTGCTGGAGCTGCCGCAGATCGCCGTGGTGGGCGGCCAG
AGCGCCGGCAAGAGCTCGGTGCTCGAGAACTTCGTGGGCAGGGACTTTCTCCCTCGAGGG
TCGGGCATTGTAACAAGACGACCTCTTGTGCTGCAGCTTGTTACTTCTAAAGCAGAATAT
GCCGAGTTTCTACATTGCAAAGGAAAGAAATTTACAGATTTTGATGAAGTTCGCCTTGAG
ATTGAAGCAGAAACAGATCGCGTGACTGGAATGAATAAAGGCATTTCCTCCATACCCATT
AATTTACGAGTCTATTCCCCACACGTGTTAAATCTAACCCTTATTGATCTACCTGGAATA
ACTAAAGTGCCTGTGGGAGATCAGCCACCAGATATCGAGTATCAGATCAGAGAAATGATT
ATGCAGTTCATCACGAGGGAGAACTGTCTGATTTTAGCTGTTACTCCAGCCAACACTGAT
CTTGCAAACTCAGATGCGCTGAAGCTAGCTAAAGAAGTTGATCCTCAAGGTCTGAGAACC
ATTGGAGTTATCACCAAACTGGACCTTATGGATGAAGGAACGGATGCCAGGGATGTTCTA
GAGAACAAACTGTTGCCTCTTCGCAGGGGTTACGTGGGGGTGGTAAACAGAAGCCAGAAG
GACATAGATGGGAAGAAGGACATAAAGGCAGCCATGCTGGCAGAGAGGAAGTTTTTCCTT
TCCCACCCGGCTTACAGACATATCGCTGACCGAATGGGAACCCCACACCTGCAGAAGGTC
CTTAATCAGCAACTTACCAACCACATTCGGGATACCCTACCAAACTTCAGGAACAAACTA
CAGGGACAGTTGCTCTCCATAGAACATGAAGTAGAAGCCTACAAAAATTTCAAACCAGAA
GACCCAACAAGGAAGACCAAAGCATTGCTGCAGATGGTTCAGCAATTTGCTGTGGACTTT
GAGAAGAGAATTGAAGGGTCAGGGGATCAAGTAGATACCCTGGAACTCTCAGGTGGTGCT
AAAATCAATCGTATTTTTCATGAACGCTTTCCTTTTGAGATAGTAAAGATGGAGTTCAAT
GAGAAAGAATTGCGAAGAGAAATAAGCTATGCAATCAAAAACATACATGGTATCAGGACA
GGGTTGTTTACTCCAGACATGGCATTTGAAGCGATAGTCAAGAAACAGATTGTAAAGTTG
AAAGGGCCTTCCTTGAAGAGTGTGGATCTGGTAATACAAGAATTAATCAACACTGTGAAG
AAGTGTACCAAAAAACTGGCAAACTTCCCCAGACTCTGCGAGGAAACGGAAAGGATTGTT
GCTAACCACATTCGTGAGCGAGAAGGGAAGACAAAGGACCAGGTATTGCTATTGATTGAC
ATTCAAGTCTCTTACATCAACACCAACCATGAAGACTTCATTGGCTTCGCAAATGCTCAG
CAGAGGAGCAGTCAGGTTCACAAGAAAACCACAGTTGGAAATCAGGTGATTCGCAAGGGG
TGGCTCACCATCAGCAACATTGGCATCATGAAAGGCGGCTCGAAGGGATACTGGTTCGTC
CTTACTGCGGAAAGCTTGTCCTGGTATAAAGATGATGAGGAAAAAGAAAAGAAGTACATG
CTTCCCTTGGACAACCTGAAAGTTCGGGATGTGGAAAAGAGCTTTATGTCTAGCAAGCAC
ATCTTTGCACTCTTTAATACAGAGCAAAGGAATGTATACAAAGACTATCGCTTCCTTGAG
CTGGCATGTGATTCCCAGGAGGATGTCGACAGCTGGAAGGCATCTCTACTAAGAGCTGGG
GTCTATCCTGACAAATCTGTAGCTGAAAATGATGAGAATGGACAAGCAGAAAACTTTTCC
ATGGACCCACAATTGGAGAGGCAAGTGGAGACCATTCGCAACCTCGTAGACTCCTACATG
TCCATTATCAACAAATGTATCCGAGATCTAATTCCAAAAACAATAATGCACCTTATGATC
AATAACGTTAAAGATTTCATAAATTCCGAGCTCCTAGCACAGTTGTATTCTTCAGAGGAC
CAAAATACCCTGATGGAGGAATCTGCTGAGCAGGCTCAGCGCCGGGATGAGATGCTTCGA
ATGTATCAAGCACTGAAAGAAGCCCTTGGGATAATTGGGGACATCAGCACAGCCACCGTG
TCCACTCCGGCACCCCCTCCAGTGGATGACTCCTGGATACAGCACTCTCGCAGGTCACCT
CCTCCAAGCCCCACAACCCAAAGGAGGCCAACACTAAGTGCTCCCCTCGCAAGGCCCACA
TCCGGCCGAGGACCAGCTCCTGCCATTCCCTCTCCTGGCCCCCACTCTGGGGCTCCTCCA
GTCCCATTCCGTCCAGGCCCATTACCTCCTTTCCCCAGCAGCAGTGACTCCTTCGGAGCC
CCTCCACAAGTTCCATCTAGGCCTACGAGGGCCCCGCCCAGTGTCCCAAGCCGGAGACCA
CCCCCATCACCAACTCGTCCCACTATAATCCGCCCACTAGAATCCTCCCTGTTAGACTAA
Protein Properties
Number of Residues 869
Molecular Weight 96681.0
Theoretical pI 8.228
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dynamin-3
MGNREMEELIPLVNRLQDAFSALGQSCLLELPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLVLQLVTSKAEYAEFLHCKGKKFTDFDEVRLEIEAETDRVTGMNKGISSIPI
NLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIREMIMQFITRENCLILAVTPANTD
LANSDALKLAKEVDPQGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYVGVVNRSQK
DIDGKKDIKAAMLAERKFFLSHPAYRHIADRMGTPHLQKVLNQQLTNHIRDTLPNFRNKL
QGQLLSIEHEVEAYKNFKPEDPTRKTKALLQMVQQFAVDFEKRIEGSGDQVDTLELSGGA
KINRIFHERFPFEIVKMEFNEKELRREISYAIKNIHGIRTGLFTPDMAFEAIVKKQIVKL
KGPSLKSVDLVIQELINTVKKCTKKLANFPRLCEETERIVANHIREREGKTKDQVLLLID
IQVSYINTNHEDFIGFANAQQRSSQVHKKTTVGNQGTNLPPSRQIVIRKGWLTISNIGIM
KGGSKGYWFVLTAESLSWYKDDEEKEKKYMLPLDNLKVRDVEKSFMSSKHIFALFNTEQR
NVYKDYRFLELACDSQEDVDSWKASLLRAGVYPDKSVAENDENGQAENFSMDPQLERQVE
TIRNLVDSYMSIINKCIRDLIPKTIMHLMINNVKDFINSELLAQLYSSEDQNTLMEESAE
QAQRRDEMLRMYQALKEALGIIGDISTATVSTPAPPPVDDSWIQHSRRSPPPSPTTQRRP
TLSAPLARPTSGRGPAPAIPSPGPHSGAPPVPFRPGPLPPFPSSSDSFGAPPQVPSRPTR
APPSVPSRRPPPSPTRPTIIRPLESSLLD
GenBank ID Protein 209915561
UniProtKB/Swiss-Prot ID Q9UQ16
UniProtKB/Swiss-Prot Entry Name DYN3_HUMAN
PDB IDs
GenBank Gene ID NM_001136127
GeneCard ID DNM3
GenAtlas ID DNM3
HGNC ID HGNC:29125
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A: Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. [PubMed:11230166 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]