You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08369
Secondary Accession Numbers
  • 14081
Name Elongation factor G, mitochondrial
Synonyms
  1. EF-Gmt
  2. Elongation factor G 1, mitochondrial
  3. Elongation factor G1
  4. hEFG1
  5. mEF-G 1
Gene Name GFM1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Mitochondrial GTPase that plays a central role in protein elongation by promoting the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. Does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleic acid binding
translation factor activity, nucleic acid binding
translation elongation factor activity
nucleoside-triphosphatase activity
rna binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
metabolic process
biosynthetic process
translational elongation
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location Chromosome:3
Locus 3q25
SNPs GFM1
Gene Sequence
>2256 bp
ATGAGACTCCTGGGAGCTGCAGCCGTCGCGGCTCTGGGGCGCGGAAGGGCCCCCGCCTCC
CTAGGCTGGCAGAGGAAGCAGGTTAATTGGAAGGCCTGCCGATGGTCTTCATCAGGGGTG
ATTCCTAATGAAAAAATACGAAATATTGGAATCTCAGCTCACATTGATTCTGGGAAAACT
ACATTAACAGAACGAGTCCTTTACTACACTGGCAGAATTGCAAAGATGCATGAGGTGAAA
GGTAAAGATGGAGTTGGTGCTGTCATGGATTCCATGGAACTAGAGAGACAAAGAGGAATC
ACTATTCAGTCAGCAGCCACTTACACCATGTGGAAAGATGTCAATATTAACATTATAGAT
ACTCCTGGGCATGTGGACTTCACAATAGAAGTGGAAAGGGCCCTGAGAGTGTTGGATGGT
GCAGTCCTTGTTCTCTGTGCTGTTGGAGGGGTACAGTGCCAGACCATGACTGTCAATCGT
CAGATGAAGCGCTACAACGTTCCGTTTCTAACTTTTATTAACAAATTGGACCGAATGGGC
TCCAACCCAGCCAGGGCCCTGCAGCAAATGAGGTCTAAACTAAATCATAATGCAGCGTTT
ATGCAGATACCCATGGGTTTGGAGGGTAATTTTAAAGGTATTGTAGATCTTATTGAGGAA
CGAGCCATCTATTTTGATGGAGACTTTGGTCAGATTGTTCGATATGGTGAGATTCCAGCT
GAATTAAGGGCGGCGGCCACTGACCACCGGCAGGAGCTAATTGAATGTGTTGCCAATTCA
GATGAACAGCTTGGTGAGATGTTTCTGGAAGAAAAAATCCCCTCGATTTCTGATTTAAAG
CTAGCAATTCGAAGAGCTACTCTGAAAAGATCATTTACTCCTGTATTTTTGGGAAGCGCC
TTGAAGAACAAAGGAGTTCAGCCTCTTTTAGATGCTGTTTTAGAATACCTCCCAAATCCA
TCTGAAGTCCAGAACTATGCTATTCTCAATAAAGAGGATGACTCAAAAGAGAAAACCAAA
ATCCTAATGAACTCCAGTAGAGACAATTCCCACCCATTTGTAGGCCTGGCTTTTAAACTG
GAGGTAGGTCGATTTGGACAATTAACTTATGTTCGCAGTTATCAGGGAGAGCTAAAGAAG
GGTGACACCATCTATAACACAAGGACAAGAAAGAAAGTACGGTTGCAACGGCTGGCTCGC
ATGCATGCCGACATGATGGAGGATGTTGAGGAAGTATATGCCGGAGACATCTGTGCATTG
TTTGGCATTGACTGTGCTAGTGGAGACACATTCACAGACAAAGCCAACAGCGGCCTTTCT
ATGGAGTCAATTCATGTTCCTGATCCTGTCATTTCAATAGCAATGAAGCCTTCTAACAAG
AACGATCTGGAAAAATTTTCAAAAGGTATTGGCAGGTTTACAAGAGAAGATCCCACATTT
AAAGTATACTTTGACACTGAGAACAAAGAGACAGTTATATCTGGAATGGGAGAATTACAC
CTGGAAATCTATGCTCAGAGGCTGGAAAGAGAGTATGGCTGTCCTTGTATCACAGGAAAG
CCAAAAGTTGCCTTTCGAGAGACCATTACTGCCCCTGTCCCGTTTGACTTTACACATAAA
AAACAATCAGGTGGTGCAGGCCAGTATGGAAAAGTAATAGGTGTCCTGGAGCCTCTGGAC
CCAGAGGACTACACTAAATTGGAATTTTCAGATGAAACATTCGGATCAAATATTCCAAAG
CAGTTTGTGCCTGCTGTAGAAAAGGGGTTTTTAGATGCCTGCGAGAAGGGCCCTCTTTCT
GGTCACAAGCTCTCTGGGCTCCGGTTTGTCCTGCAAGATGGAGCACACCACATGGTTGAT
TCTAATGAAATCTCTTTCATCCGAGCAGGAGAAGGTGCTCTTAAACAAGCCTTGGCAAAT
GCAACATTATGTATTCTTGAACCTATTATGGCTGTGGAAGTTGTAGCTCCAAATGAATTT
CAGGGACAAGTAATTGCAGGAATTAACCGACGCCATGGGGTAATCACTGGGCAAGATGGA
GTTGAGGACTATTTTACACTGTATGCAGATGTCCCTCTAAATGATATGTTTGGTTATTCC
ACTGAACTTAGGTCATGCACAGAGGGAAAGGGAGAATACACAATGGAGTATAGCAGGTAT
CAGCCATGTTTACCATCCACACAAGAAGACGTCATTAATAAGTATTTGGAAGCTACAGGT
CAACTTCCTGTTAAAAAAGGAAAAGCCAAGAACTAA
Protein Properties
Number of Residues 751
Molecular Weight 83470.9
Theoretical pI 7.01
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Elongation factor G, mitochondrial
MRLLGAAAVAALGRGRAPASLGWQRKQVNWKACRWSSSGVIPNEKIRNIGISAHIDSGKT
TLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNINIID
TPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMG
SNPARALQQMRSKLNHNAAFMQIPMGLEGNFKGIVDLIEERAIYFDGDFGQIVRYGEIPA
ELRAAATDHRQELIECVANSDEQLGEMFLEEKIPSISDLKLAIRRATLKRSFTPVFLGSA
LKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDDSKEKTKILMNSSRDNSHPFVGLAFKL
EVGRFGQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICAL
FGIDCASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTF
KVYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKPKVAFRETITAPVPFDFTHK
KQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLS
GHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEF
QGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRY
QPCLPSTQEDVINKYLEATGQLPVKKGKAKN
GenBank ID Protein 18390331
UniProtKB/Swiss-Prot ID Q96RP9
UniProtKB/Swiss-Prot Entry Name EFGM_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_024996.5
GeneCard ID GFM1
GenAtlas ID GFM1
HGNC ID HGNC:13780
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  5. Gao J, Yu L, Zhang P, Jiang J, Chen J, Peng J, Wei Y, Zhao S: Cloning and characterization of human and mouse mitochondrial elongation factor G, GFM and Gfm, and mapping of GFM to human chromosome 3q25.1-q26.2. Genomics. 2001 May 15;74(1):109-14. [PubMed:11374907 ]
  6. Hammarsund M, Wilson W, Corcoran M, Merup M, Einhorn S, Grander D, Sangfelt O: Identification and characterization of two novel human mitochondrial elongation factor genes, hEFG2 and hEFG1, phylogenetically conserved through evolution. Hum Genet. 2001 Nov;109(5):542-50. Epub 2001 Oct 13. [PubMed:11735030 ]
  7. Tsuboi M, Morita H, Nozaki Y, Akama K, Ueda T, Ito K, Nierhaus KH, Takeuchi N: EF-G2mt is an exclusive recycling factor in mammalian mitochondrial protein synthesis. Mol Cell. 2009 Aug 28;35(4):502-10. doi: 10.1016/j.molcel.2009.06.028. [PubMed:19716793 ]
  8. Coenen MJ, Antonicka H, Ugalde C, Sasarman F, Rossi R, Heister JG, Newbold RF, Trijbels FJ, van den Heuvel LP, Shoubridge EA, Smeitink JA: Mutant mitochondrial elongation factor G1 and combined oxidative phosphorylation deficiency. N Engl J Med. 2004 Nov 11;351(20):2080-6. [PubMed:15537906 ]
  9. Valente L, Tiranti V, Marsano RM, Malfatti E, Fernandez-Vizarra E, Donnini C, Mereghetti P, De Gioia L, Burlina A, Castellan C, Comi GP, Savasta S, Ferrero I, Zeviani M: Infantile encephalopathy and defective mitochondrial DNA translation in patients with mutations of mitochondrial elongation factors EFG1 and EFTu. Am J Hum Genet. 2007 Jan;80(1):44-58. Epub 2006 Nov 15. [PubMed:17160893 ]