Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08371
Secondary Accession Numbers
  • 14083
Name Elongation factor Ts, mitochondrial
Synonyms
  1. EF-Ts
  2. EF-TsMt
Gene Name TSFM
Protein Type Unknown
Biological Properties
General Function Involved in translation elongation factor activity
Specific Function Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF- Tu.GTP complex up to the GTP hydrolysis stage on the ribosome
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
binding
nucleic acid binding
translation factor activity, nucleic acid binding
translation elongation factor activity
rna binding
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
metabolic process
biosynthetic process
translational elongation
Cellular Location
  1. Mitochondrion
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14.1
SNPs TSFM
Gene Sequence
>978 bp
ATGTCGCTGCTGCGGTCGCTGCGCGTGTTTCTGGTCGCGCGGACCGGGAGCTACCCGGCT
GGGTCTCTTCTGCGTCAGTCGCCCCAGCCAAGGCACACATTTTATGCTGGGCCCCGTCTG
TCTGCCTCGGCCTCCAGCAAGGAGCTCCTCATGAAGCTGCGGCGGAAAACAGGCTACTCC
TTTGTAAATTGCAAGAAAGCTCTGGAGACTTGTGGCGGGGACCTCAAACAGGCAGAGATC
TGGCTCCACAAGGAGGCCCAGAAGGAGGGCTGGAGCAAAGCTGCCAAGCTCCAAGGGAGG
AAGACCAAAGAAGGCCTGATTGGGCTGTTGCAGGAAGGAAACACAACTGTATTAGTAGAG
GTAAACTGTGAGACAGATTTTGTTTCTAGAAATTTAAAATTTCAACTGTTGGTCCAGCAA
GTAGCCCTTGGAACCATGATGCATTGTCAGACCCTAAAGGATCAACCCTCTGCATACAGT
AAAGGTTTCTTGAATTCCTCTGAGCTTTCTGGACTTCCAGCTGGGCCTGACAGAGAAGGC
TCACTCAAGGATCAGTTGGCTTTAGCAATTGGAAAACTGGGAGAAAACATGATTCTTAAA
CGAGCTGCATGGGTGAAGGTGCCATCTGGGTTCTACGTTGGCTCTTATGTCCACGGAGCA
ATGCAGAGTCCCTCACTTCACAAGCTGGTGCTGGGGAAGTATGGGGCCCTGGTCATCTGT
GAGACGTCTGAACAGAAAACAAACCTTGAAGACGTTGGCCGCCGCCTTGGGCAGCATGTG
GTGGGCATGGCCCCCCTCTCTGTTGGCTCCCTGGACGATGAGCCTGGGGGAGAGGCAGAG
ACTAAGATGCTGTCCCAGCCGTATTTGCTGGATCCCTCCATTACCTTGGGGCAGTATGTG
CAGCCTCAGGGGGTGTCGGTAGTAGACTTTGTGCGGTTTGAATGTGGAGAAGGTGAAGAG
GCAGCAGAAACTGAATAG
Protein Properties
Number of Residues 325
Molecular Weight 35390.4
Theoretical pI 8.56
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Elongation factor Ts, mitochondrial
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHGAMQSPSLHKLVLGKYGALVIC
ETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQYV
QPQGVSVVDFVRFECGEGEEAAETE
GenBank ID Protein 4416086
UniProtKB/Swiss-Prot ID P43897
UniProtKB/Swiss-Prot Entry Name EFTS_HUMAN
PDB IDs
GenBank Gene ID AF110399
GeneCard ID TSFM
GenAtlas ID TSFM
HGNC ID HGNC:12367
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wang Y, Du D, Fang L, Yang G, Zhang C, Zeng R, Ullrich A, Lottspeich F, Chen Z: Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling. EMBO J. 2006 Nov 1;25(21):5058-70. Epub 2006 Oct 19. [PubMed:17053785 ]
  3. Xin H, Woriax V, Burkhart W, Spremulli LL: Cloning and expression of mitochondrial translational elongation factor Ts from bovine and human liver. J Biol Chem. 1995 Jul 21;270(29):17243-9. [PubMed:7615523 ]
  4. Smeitink JA, Elpeleg O, Antonicka H, Diepstra H, Saada A, Smits P, Sasarman F, Vriend G, Jacob-Hirsch J, Shaag A, Rechavi G, Welling B, Horst J, Rodenburg RJ, van den Heuvel B, Shoubridge EA: Distinct clinical phenotypes associated with a mutation in the mitochondrial translation elongation factor EFTs. Am J Hum Genet. 2006 Nov;79(5):869-77. Epub 2006 Sep 15. [PubMed:17033963 ]