You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08375
Secondary Accession Numbers
  • 14087
Name Translation initiation factor eIF-2B subunit beta
Synonyms
  1. S20I15
  2. S20III15
  3. eIF-2B GDP-GTP exchange factor subunit beta
Gene Name EIF2B2
Protein Type Unknown
Biological Properties
General Function Involved in cellular metabolic process
Specific Function Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP
Pathways Not Available
Reactions Not Available
GO Classification
Process
metabolic process
cellular metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 14q24.3
SNPs EIF2B2
Gene Sequence
>1056 bp
ATGCCGGGATCCGCAGCGAAGGGCTCGGAGTTGTCAGAGAGGATCGAGAGCTTCGTGGAG
ACCCTGAAGCGGGGTGGTGGGCCGCGCAGCTCCGAGGAAATGGCTCGGGAGACCCTAGGG
TTGCTGCGCCAGATCATCACGGACCACCGCTGGAGCAACGCGGGGGAGCTGATGGAGCTG
ATCCGCAGAGAGGGCAGGAGGATGACGGCCGCTCAGCCCTCCGAGACCACCGTGGGCAAC
ATGGTGCGGAGAGTGCTCAAGATTATCCGGGAGGAGTATGGCAGACTCCATGGACGCAGC
GACGAGAGTGATCAGCAGGAGTCCCTGCACAAACTGTTGACATCCGGAGGCCTAAACGAG
GATTTCAGCTTCCATTATGCCCAACTCCAGTCCAACATCATTGAGGCGATTAATGAGCTG
CTAGTGGAGCTGGAAGGGACAATGGAGAACATTGCAGCCCAGGCTCTGGAGCACATTCAC
TCCAATGAGGTGATCATGACCATTGGCTTCTCCCGAACAGTAGAGGCCTTCCTCAAAGAG
GCTGCCCGAAAGAGGAAATTCCATGTCATTGTAGCAGAGTGTGCTCCTTTCTGCCAGGGT
CATGAAATGGCTGTGAATTTGTCCAAAGCAGGTATTGAGACAACTGTCATGACTGATGCT
GCCATTTTTGCCGTTATGTCAAGAGTCAACAAGGTGATCATTGGCACGAAGACCATCCTG
GCCAATGGGGCCCTGAGAGCTGTGACAGGAACTCACACTCTGGCACTGGCAGCAAAACAC
CATTCCACCCCACTCATCGTCTGTGCACCTATGTTCAAACTTTCTCCACAGTTCCCCAAT
GAAGAAGACTCATTTCATAAGTTTGTGGCTCCTGAAGAAGTCCTGCCATTCACAGAAGGG
GACATTCTGGAGAAGGTCAGCGTGCATTGCCCTGTGTTTGACTACGTTCCCCCAGAGCTC
ATTACCCTCTTTATCTCCAACATTGGTGGGAATGCACCTTCCTACATCTACCGCCTGATG
AGTGAACTCTACCATCCTGATGATCATGTTTTATGA
Protein Properties
Number of Residues 351
Molecular Weight 38989.3
Theoretical pI 6.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Translation initiation factor eIF-2B subunit beta
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
GenBank ID Protein 4809338
UniProtKB/Swiss-Prot ID P49770
UniProtKB/Swiss-Prot Entry Name EI2BB_HUMAN
PDB IDs Not Available
GenBank Gene ID AC006530
GeneCard ID EIF2B2
GenAtlas ID EIF2B2
HGNC ID HGNC:3258
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  3. Sherrington R, Rogaev EI, Liang Y, Rogaeva EA, Levesque G, Ikeda M, Chi H, Lin C, Li G, Holman K, Tsuda T, Mar L, Foncin JF, Bruni AC, Montesi MP, Sorbi S, Rainero I, Pinessi L, Nee L, Chumakov I, Pollen D, Brookes A, Sanseau P, Polinsky RJ, Wasco W, Da Silva HA, Haines JL, Perkicak-Vance MA, Tanzi RE, Roses AD, Fraser PE, Rommens JM, St George-Hyslop PH: Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease. Nature. 1995 Jun 29;375(6534):754-60. [PubMed:7596406 ]
  4. Leegwater PA, Vermeulen G, Konst AA, Naidu S, Mulders J, Visser A, Kersbergen P, Mobach D, Fonds D, van Berkel CG, Lemmers RJ, Frants RR, Oudejans CB, Schutgens RB, Pronk JC, van der Knaap MS: Subunits of the translation initiation factor eIF2B are mutant in leukoencephalopathy with vanishing white matter. Nat Genet. 2001 Dec;29(4):383-8. [PubMed:11704758 ]
  5. Fogli A, Rodriguez D, Eymard-Pierre E, Bouhour F, Labauge P, Meaney BF, Zeesman S, Kaneski CR, Schiffmann R, Boespflug-Tanguy O: Ovarian failure related to eukaryotic initiation factor 2B mutations. Am J Hum Genet. 2003 Jun;72(6):1544-50. Epub 2003 Apr 21. [PubMed:12707859 ]