You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08376
Secondary Accession Numbers
  • 14088
Name Translation initiation factor eIF-2B subunit delta
Synonyms
  1. eIF-2B GDP-GTP exchange factor subunit delta
Gene Name EIF2B4
Protein Type Unknown
Biological Properties
General Function Involved in cellular metabolic process
Specific Function Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP
Pathways Not Available
Reactions Not Available
GO Classification
Process
metabolic process
cellular metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:2
Locus 2p23.3
SNPs EIF2B4
Gene Sequence
>1572 bp
ATGGCTGCTGTGGCCGTGGCTGTTCGCGAGGACTCGGGATCCGGGATGAAGGCGGAGCTT
CCCCCTGGGCCTGGGGCAGTGGGGAGGGAAATGACCAAAGAAGAAAAGCTGCAGCTTCGG
AAGGAAAAGAAACAGCAGAAGAAGAAACGGAAGGAAGAAAAGGGGGCAGAACCAGAGACT
GGCTCTGCTGTATCTGCAGCCCAATGTCAAGTAGGCCCAACCAGAGAACTGCCAGAATCG
GGCATTCAGTTGGGCACTCCTCGGGAGAAAGTTCCAGCTGGTCGGAGTAAGGCCGAACTT
CGGGCTGAGCGTCGAGCCAAGCAGGAGGCCGAGCGGGCCCTGAAACAGGCAAGAAAAGGG
GAACAAGGAGGACCACCTCCTAAGGCCAGCCCCAGCACAGCTGGAGAAACCCCCTCAGGA
GTGAAGCGTCTCCCTGAGTACCCTCAGGTTGATGACCTACTTCTGAGAAGGCTTGTTAAA
AAACCAGAGCGTCAACAGGTTCCTACACGAAAGGATTATGGATCCAAAGTCAGTCTCTTC
TCTCACCTACCCCAGTACAGCAGACAAAACTCTCTGACCCAGTTTATGAGCATCCCATCC
TCTGTGATCCACCCAGCCATGGTGCGACTCGGCCTGCAGTACTCCCAGGGCCTGGTCAGT
GGCTCCAATGCCCGGTGTATTGCCCTGCTTCGTGCCTTGCAGCAGGTGATTCAGGATTAC
ACAACACCGCCTAATGAAGAACTCTCCAGGGATCTAGTGAATAAACTAAAACCCTACATG
AGCTTCCTGACTCAGTGCCGTCCCCTGTCAGCGAGCATGCACAACGCCATCAAGTTCCTT
AACAAGGAAATCACCAGTGTGGGCAGTTCCAAGCGGGAAGAGGAGGCCAAGTCAGAACTT
CGAGCAGCCATTGATCGGTATGTGCAAGAGAAGATTGTGCTAGCAGCTCAGGCAATTTCA
CGCTTTTCTTACCAGAAGATCAGTAATGGAGATGTGATCCTGGTATATGGATGCTCATCT
CTGGTATCACGAATTCTTCAGGAGGCTTGGACAGAGGGCCGGCGGTTTCGGGTGGTAGTG
GTGGACAGCCGGCCATGGCTGGAAGGAAGGCACACACTACGTTCTCTAGTCCATGCTGGT
GTCCCAGCCTCCTACCTGCTGATTCCTGCAGCCTCCTATGTGCTCCCAGAGGTTTCCAAG
GTGCTATTGGGAGCTCATGCACTCTTGGCCAACGGGTCTGTGATGTCACGGGTAGGGACA
GCACAGTTAGCCCTGGTGGCTCGAGCCCATAATGTACCAGTGCTGGTTTGCTGTGAAACA
TACAAGTTCTGTGAGCGTGTGCAGACTGATGCCTTTGTCTCTAATGAGCTAGATGACCCT
GATGATCTGCAATGTAAGCGGGGAGAACATGTTGCGCTGGCTAACTGGCAGAACCACGCA
CTCCTACGGTTGTTGAATCTAGTCTATGATGTGACTCCCCCAGAGCTTGTGGATCTGGTG
ATCACGGAGCTGGGGATGATCCCTTGCAGTTCTGTACCTGTTGTTCTACGAGTCAAGAGC
AGTGACCAGTGA
Protein Properties
Number of Residues 523
Molecular Weight 57556.7
Theoretical pI 9.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Translation initiation factor eIF-2B subunit delta
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
GenBank ID Protein 6563202
UniProtKB/Swiss-Prot ID Q9UI10
UniProtKB/Swiss-Prot Entry Name EI2BD_HUMAN
PDB IDs Not Available
GenBank Gene ID AF112207
GeneCard ID EIF2B4
GenAtlas ID EIF2B4
HGNC ID HGNC:3260
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  8. van der Knaap MS, Leegwater PA, Konst AA, Visser A, Naidu S, Oudejans CB, Schutgens RB, Pronk JC: Mutations in each of the five subunits of translation initiation factor eIF2B can cause leukoencephalopathy with vanishing white matter. Ann Neurol. 2002 Feb;51(2):264-70. [PubMed:11835386 ]
  9. Fogli A, Rodriguez D, Eymard-Pierre E, Bouhour F, Labauge P, Meaney BF, Zeesman S, Kaneski CR, Schiffmann R, Boespflug-Tanguy O: Ovarian failure related to eukaryotic initiation factor 2B mutations. Am J Hum Genet. 2003 Jun;72(6):1544-50. Epub 2003 Apr 21. [PubMed:12707859 ]