You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08377
Secondary Accession Numbers
  • 14089
Name Translation initiation factor eIF-2B subunit epsilon
Synonyms
  1. eIF-2B GDP-GTP exchange factor subunit epsilon
Gene Name EIF2B5
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:3
Locus 3q27.1
SNPs EIF2B5
Gene Sequence
>2166 bp
ATGGCGGCCCCTGTAGTGGCGCCGCCTGGTGTGGTGGTTAGTCGGGCTAACAAGCGCAGC
GGCGCGGGGCCGGGAGGCAGCGGTGGCGGGGGAGCCAGAGGGGCGGAGGAGGAACCGCCG
CCGCCCCTACAAGCAGTTCTGGTGGCCGATAGCTTCGATCGCCGCTTCTTCCCCATCTCC
AAGGACCAGCCTCGGGTCCTCTTGCCCCTGGCCAATGTGGCATTAATTGACTACACTCTG
GAATTCCTGACTGCCACAGGTGTACAGGAAACATTTGTCTTTTGTTGCTGGAAAGCTGCT
CAAATCAAAGAACATTTACTGAAGTCAAAGTGGTGCCGCCCTACATCTCTCAATGTGGTT
CGAATAATTACATCAGAGCTCTATCGATCACTGGGAGATGTCCTCCGTGATGTTGATGCC
AAGGCTTTGGTGCGCTCTGACTTTCTTCTGGTGTATGGGGATGTCATCTCAAACATCAAT
ATCACCAGAGCCCTTGAGGAACACAGGTTGAGACGGAAGCTAGAAAAAAATGTTTCTGTG
ATGACGATGATCTTCAAGGAGTCATCCCCCAGCCACCCAACTCGTTGCCACGAAGACAAT
GTGGTAGTGGCTGTGGATAGTACCACAAACAGGGTTCTCCATTTTCAGAAGACCCAGGGT
CTCCGGCGTTTTGCATTTCCTCTGAGCCTGTTTCAGGGCAGTAGTGATGGAGTGGAGGTT
CGATATGATTTACTGGATTGTCATATCAGCATCTGTTCTCCTCAGGTGGCACAACTCTTT
ACAGACAACTTTGACTACCAAACTCGAGATGACTTTGTGCGAGGTCTCTTAGTGAATGAG
GAGATCCTAGGGAACCAGATCCACATGCACGTAACAGCTAAGGAATATGGTGCCCGTGTC
TCCAACCTACACATGTACTCAGCTGTCTGTGCTGACGTCATCCGCCGATGGGTCTACCCT
CTCACCCCAGAGGCGAACTTCACTGACAGCACCACCCAGAGCTGCACTCATTCCCGGCAC
AACATCTACCGAGGGCCTGAGGTCAGCCTGGGCCATGGCAGCATCCTAGAGGAAAATGTG
CTCCTGGGCTCTGGCACTGTCATTGGCAGCAATTGCTTTATCACCAACAGTGTCATTGGC
CCCGGCTGCCACATTGGTGATAACGTGGTGCTGGACCAGACCTACCTGTGGCAGGGTGTT
CGAGTGGCGGCTGGAGCACAGATCCATCAGTCTCTGCTTTGTGACAATGCTGAGGTCAAG
GAACGAGTGACACTGAAACCACGCTCTGTCCTCACTTCCCAGGTGGTCGTGGGCCCAAAT
ATCACGCTGCCTGAGGGCTCGGTGATCTCTTTGCACCCTCCAGATGCAGAGGAAGATGAA
GATGATGGCGAGTTCAGTGATGATTCTGGGGCTGACCAAGAAAAGGACAAAGTGAAGATG
AAAGGTTACAATCCAGCAGAAGTAGGAGCTGCTGGCAAGGGCTACCTCTGGAAAGCTGCA
GGCATGAACATGGAGGAAGAGGAGGAACTGCAGCAGAATCTGTGGGGACTCAAGATCAAC
ATGGAAGAAGAGAGTGAAAGTGAAAGTGAGCAAAGTATGGATTCTGAGGAGCCGGACAGC
CGGGGAGGCTCCCCTCAGATGGATGACATCAAAGTGTTCCAGAATGAAGTTTTAGGAACA
CTACAGCGGGGCAAAGAGGAGAACATTTCTTGTGACAATCTCGTCCTGGAAATCAACTCT
CTCAAGTATGCCTATAACATAAGTCTAAAGGAGGTGATGCAGGTACTGAGCCACGTGGTC
CTGGAGTTCCCCCTGCAACAGATGGATTCCCCGCTTGACTCAAGCCGCTACTGTGCCCTG
CTGCTTCCTCTGCTAAAGGCCTGGAGCCCTGTTTTTAGGAACTACATAAAGCGCGCAGCC
GACCATTTGGAAGCGTTAGCAGCCATTGAGGACTTCTTCCTAGAGCATGAAGCTCTTGGT
ATTTCCATGGCCAAGGTACTGATGGCTTTCTACCAGCTGGAGATCCTGGCTGAGGAAACA
ATTCTGAGCTGGTTCAGCCAAAGAGATACAACTGACAAGGGCCAGCAGTTGCGCAAGAAT
CAACAGCTGCAGAGGTTCATCCAGTGGCTAAAAGAGGCAGAAGAGGAGTCATCTGAAGAT
GACTGA
Protein Properties
Number of Residues 721
Molecular Weight 80379.2
Theoretical pI 4.72
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Translation initiation factor eIF-2B subunit epsilon
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
GenBank ID Protein 83267879
UniProtKB/Swiss-Prot ID Q13144
UniProtKB/Swiss-Prot Entry Name EI2BE_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003907.2
GeneCard ID EIF2B5
GenAtlas ID EIF2B5
HGNC ID HGNC:3261
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  11. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  12. Gevaert K, Staes A, Van Damme J, De Groot S, Hugelier K, Demol H, Martens L, Goethals M, Vandekerckhove J: Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC. Proteomics. 2005 Sep;5(14):3589-99. [PubMed:16097034 ]
  13. Leegwater PA, Vermeulen G, Konst AA, Naidu S, Mulders J, Visser A, Kersbergen P, Mobach D, Fonds D, van Berkel CG, Lemmers RJ, Frants RR, Oudejans CB, Schutgens RB, Pronk JC, van der Knaap MS: Subunits of the translation initiation factor eIF2B are mutant in leukoencephalopathy with vanishing white matter. Nat Genet. 2001 Dec;29(4):383-8. [PubMed:11704758 ]
  14. Fogli A, Rodriguez D, Eymard-Pierre E, Bouhour F, Labauge P, Meaney BF, Zeesman S, Kaneski CR, Schiffmann R, Boespflug-Tanguy O: Ovarian failure related to eukaryotic initiation factor 2B mutations. Am J Hum Genet. 2003 Jun;72(6):1544-50. Epub 2003 Apr 21. [PubMed:12707859 ]
  15. Asuru AI, Mellor H, Thomas NS, Yu L, Chen JJ, Crosby JS, Hartson SD, Kimball SR, Jefferson LS, Matts RL: Cloning and characterization of cDNAs encoding the epsilon-subunit of eukaryotic initiation factor-2B from rabbit and human. Biochim Biophys Acta. 1996 Jul 17;1307(3):309-17. [PubMed:8688466 ]
  16. Fogli A, Wong K, Eymard-Pierre E, Wenger J, Bouffard JP, Goldin E, Black DN, Boespflug-Tanguy O, Schiffmann R: Cree leukoencephalopathy and CACH/VWM disease are allelic at the EIF2B5 locus. Ann Neurol. 2002 Oct;52(4):506-10. [PubMed:12325082 ]