You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08381
Secondary Accession Numbers
  • 14093
Name Eukaryotic peptide chain release factor subunit 1
Synonyms
  1. Eukaryotic release factor 1
  2. Protein Cl1
  3. TB3-1
  4. eRF1
Gene Name ETF1
Protein Type Unknown
Biological Properties
General Function Involved in translation release factor activity, codon specific
Specific Function Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
binding
translation termination factor activity
translation release factor activity
translation release factor activity, codon specific
nucleic acid binding
translation factor activity, nucleic acid binding
rna binding
Process
cellular component organization or biogenesis
cellular component organization
cellular component disassembly
macromolecular complex disassembly
cellular macromolecular complex disassembly
cellular protein complex disassembly
translational termination
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:5
Locus 5q31.1
SNPs ETF1
Gene Sequence
>1314 bp
ATGGCGGACGACCCCAGTGCTGCCGACAGGAACGTGGAGATCTGGAAGATCAAGAAGCTC
ATTAAGAGCTTGGAGGCGGCCCGCGGCAATGGCACCAGCATGATATCATTGATCATTCCT
CCCAAAGACCAGATTTCACGAGTGGCAAAAATGTTAGCGGATGAGTTTGGAACTGCATCT
AACATTAAGTCACGAGTAAACCGCCTTTCAGTCCTGGGAGCCATTACATCTGTACAACAA
AGACTCAAACTTTATAACAAAGTACCTCCAAATGGTCTGGTTGTATACTGTGGAACAATT
GTAACAGAAGAAGGAAAGGAAAAGAAAGTCAACATTGACTTTGAACCTTTCAAACCAATT
AATACGTCATTGTATTTGTGTGACAACAAATTCCATACAGAGGCTCTTACAGCACTACTT
TCAGATGATAGCAAGTTTGGATTCATTGTAATAGATGGTAGTGGTGCACTTTTTGGCACA
CTCCAAGGAAACACAAGAGAAGTCCTGCACAAATTCACTGTGGATCTCCCAAAGAAACAC
GGTAGAGGAGGTCAGTCAGCCTTGCGTTTTGCCCGTTTAAGAATGGAAAAGCGACATAAC
TATGTTCGGAAAGTAGCAGAGACTGCTGTGCAGCTGTTTATTTCTGGGGACAAAGTGAAT
GTGGCTGGTCTAGTTTTAGCTGGATCCGCTGACTTTAAAACTGAACTAAGTCAATCTGAT
ATGTTTGATCAGAGGTTACAATCAAAAGTTTTAAAATTAGTTGATATATCCTATGGTGGT
GAAAATGGATTCAACCAAGCTATTGAGTTATCTACTGAAGTCCTCTCCAACGTGAAATTC
ATTCAAGAGAAGAAATTAATAGGACGATACTTTGATGAAATCAGCCAGGACACGGGCAAG
TACTGTTTTGGCGTTGAAGATACACTAAAGGCTTTGGAAATGGGAGCTGTAGAAATTCTA
ATAGTCTATGAAAATCTGGATATAATGAGATATGTTCTTCATTGCCAAGGCACAGAAGAG
GAGAAAATTCTCTATCTAACTCCAGAGCAAGAAAAGGATAAATCTCATTTCACAGACAAA
GAGACCGGACAGGAACATGAGCTTATCGAGAGCATGCCCCTGTTGGAATGGTTTGCTAAC
AACTATAAAAAATTTGGAGCTACGTTGGAAATTGTCACAGATAAATCACAAGAAGGGTCT
CAGTTTGTGAAAGGATTTGGTGGAATTGGAGGTATCTTGCGGTACCGAGTAGATTTCCAG
GGAATGGAATACCAAGGAGGAGACGATGAATTTTTTGACCTTGATGACTACTAG
Protein Properties
Number of Residues 437
Molecular Weight 49030.5
Theoretical pI 5.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic peptide chain release factor subunit 1
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY
GenBank ID Protein 5499721
UniProtKB/Swiss-Prot ID P62495
UniProtKB/Swiss-Prot Entry Name ERF1_HUMAN
PDB IDs
GenBank Gene ID AF095901
GeneCard ID ETF1
GenAtlas ID ETF1
HGNC ID HGNC:3477
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  5. Yamashita A, Izumi N, Kashima I, Ohnishi T, Saari B, Katsuhata Y, Muramatsu R, Morita T, Iwamatsu A, Hachiya T, Kurata R, Hirano H, Anderson P, Ohno S: SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay. Genes Dev. 2009 May 1;23(9):1091-105. doi: 10.1101/gad.1767209. [PubMed:19417104 ]
  6. Grenett HE, Bounelis P, Fuller GM: Identification of a human cDNA with high homology to yeast omnipotent suppressor 45. Gene. 1992 Jan 15;110(2):239-43. [PubMed:1537561 ]
  7. Frolova L, Le Goff X, Rasmussen HH, Cheperegin S, Drugeon G, Kress M, Arman I, Haenni AL, Celis JE, Philippe M, et al.: A highly conserved eukaryotic protein family possessing properties of polypeptide chain release factor. Nature. 1994 Dec 15;372(6507):701-3. [PubMed:7990965 ]
  8. Andjelkovic N, Zolnierowicz S, Van Hoof C, Goris J, Hemmings BA: The catalytic subunit of protein phosphatase 2A associates with the translation termination factor eRF1. EMBO J. 1996 Dec 16;15(24):7156-67. [PubMed:9003791 ]
  9. Guenet L, Toutain B, Guilleret I, Chauvel B, Deaven LL, Longmire JL, Le Gall JY, David V, Le Treut A: Human release factor eRF1: structural organisation of the unique functional gene on chromosome 5 and of the three processed pseudogenes. FEBS Lett. 1999 Jul 2;454(1-2):131-6. [PubMed:10413110 ]
  10. Song H, Mugnier P, Das AK, Webb HM, Evans DR, Tuite MF, Hemmings BA, Barford D: The crystal structure of human eukaryotic release factor eRF1--mechanism of stop codon recognition and peptidyl-tRNA hydrolysis. Cell. 2000 Feb 4;100(3):311-21. [PubMed:10676813 ]
  11. Ivanova EV, Kolosov PM, Birdsall B, Kelly G, Pastore A, Kisselev LL, Polshakov VI: Eukaryotic class 1 translation termination factor eRF1--the NMR structure and dynamics of the middle domain involved in triggering ribosome-dependent peptidyl-tRNA hydrolysis. FEBS J. 2007 Aug;274(16):4223-37. Epub 2007 Jul 25. [PubMed:17651434 ]