You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08382
Secondary Accession Numbers
  • 14094
Name Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Synonyms
  1. Eukaryotic peptide chain release factor subunit 3a
  2. G1 to S phase transition protein 1 homolog
  3. eRF3a
Gene Name GSPT1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Involved in translation termination in response to the termination codons UAA, UAG and UGA. Stimulates the activity of ERF1. Involved in regulation of mammalian cell growth
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 16p13.1
SNPs GSPT1
Gene Sequence
>1500 bp
ATGGAACTTTCAGAACCTATTGTAGAAAATGGAGAGACAGAAATGTCTCCAGAAGAATCA
TGGGAGCACAAAGAAGAAATAAGTGAAGCAGAGCCAGGGGGTGGTTCCTTGGGAGATGGA
AGGCCGCCAGAGGAAAGTGCCCATGAAATGATGGAGGAGGAAGAGGAAATCCCAAAACCT
AAGTCTGTGGTTGCACCGCCAGGTGCTCCTAAGAAAGAGCATGTAAATGTAGTATTCATT
GGGCACGTAGATGCTGGCAAGTCAACCATTGGAGGACAAATAATGTATTTGACTGGAATG
GTTGACAAAAGGACGCTTGAAAAGTATGAAAGAGAAGCTAAAGAGAAAAACAGAGAAACT
TGGTACTTGTCTTGGGCCTTAGACACAAATCAGGAAGAACGAGACAAGGGTAAAACAGTA
GAAGTGGGTCGTGCCTATTTTGAAACCGAAAAGAAGCATTTCACAATTCTAGATGCCCCT
GGCCACAAGAGTTTTGTCCCAAATATGATTGGTGGTGCCTCTCAAGCTGATTTGGCTGTG
CTGGTAATCTCAGCCAGGAAAGGAGAGTTTGAAACTGGATTTGAAAAAGGAGGACAGACA
AGAGAACATGCAATGTTGGCAAAGACAGCAGGTGTAAAACACCTAATTGTGCTAATTAAT
AAGATGGATGATCCAACAGTAAATTGGAGCAATGAGAGATATGAAGAATGTAAGGAGAAA
CTAGTGCCATTTTTGAAAAAAGTTGGCTTCAATCCCAAAAAGGACATTCACTTTATGCCC
TGCTCAGGACTTACTGGAGCAAATCTCAAAGAGCAGTCGGATTTCTGTCCTTGGTACATT
GGATTACCGTTTATTCCATATCTGGATAATTTGCCGAACTTCAATAGATCAGTTGATGGA
CCAATCAGGCTGCCAATTGTGGATAAGTACAAGGATATGGGCACTGTGGTCCTGGGAAAG
CTGGAATCAGGATCTATTTGTAAAGGCCAGCAGCTTGTGATGATGCCAAACAAGCACAAC
GTGGAAGTTCTTGGAATACTTTCCGATGATGTAGAGACTGATACCGTAGCCCCAGGTGAA
AACCTCAAAATCAGACTGAAAGGAATTGAAGAAGAGGAGATTCTTCCAGGGTTTATACTT
TGTGATCCTAATAATCTTTGTCATTCTGGACGCACATTTGATGCCCAGATAGTGATTATA
GAGCACAAATCCATCATCTGCCCAGGCTATAATGCGGTGCTGCATATTCATACCTGTATT
GAGGAGGTGGAAATAACAGCCTTAATCTGCTTGGTAGACAAAAAATCAGGAGAAAAAAGT
AAGACCCGACCCCGTTTTGTGAAACAAGATCAAGTATGCATTGCTCGCTTAAGGACAGCA
GGAACCATCTGCCTTGAGACCTTTAAAGACTTCCCTCAGATGGGTCGTTTCACCTTAAGA
GATGAGGGTAAGACCATTGCAATTGGAAAAGTTCTGAAACTGGTTCCAGAGAAAGACTAA
Protein Properties
Number of Residues 499
Molecular Weight 55755.6
Theoretical pI 5.34
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKP
KSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRET
WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV
LVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK
LVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGE
NLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLR
DEGKTIAIGKVLKLVPEKD
GenBank ID Protein 31921
UniProtKB/Swiss-Prot ID P15170
UniProtKB/Swiss-Prot Entry Name ERF3A_HUMAN
PDB IDs Not Available
GenBank Gene ID X17644
GeneCard ID GSPT1
GenAtlas ID GSPT1
HGNC ID HGNC:4621
References
General References
  1. Loftus BJ, Kim UJ, Sneddon VP, Kalush F, Brandon R, Fuhrmann J, Mason T, Crosby ML, Barnstead M, Cronin L, Deslattes Mays A, Cao Y, Xu RX, Kang HL, Mitchell S, Eichler EE, Harris PC, Venter JC, Adams MD: Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q. Genomics. 1999 Sep 15;60(3):295-308. [PubMed:10493829 ]
  2. Yamashita A, Izumi N, Kashima I, Ohnishi T, Saari B, Katsuhata Y, Muramatsu R, Morita T, Iwamatsu A, Hachiya T, Kurata R, Hirano H, Anderson P, Ohno S: SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay. Genes Dev. 2009 May 1;23(9):1091-105. doi: 10.1101/gad.1767209. [PubMed:19417104 ]
  3. Hoshino S, Miyazawa H, Enomoto T, Hanaoka F, Kikuchi Y, Kikuchi A, Ui M: A human homologue of the yeast GST1 gene codes for a GTP-binding protein and is expressed in a proliferation-dependent manner in mammalian cells. EMBO J. 1989 Dec 1;8(12):3807-14. [PubMed:2511002 ]