Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08383
Secondary Accession Numbers
  • 14095
Name Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
Synonyms
  1. Eukaryotic peptide chain release factor subunit 3b
  2. G1 to S phase transition protein 2 homolog
  3. eRF3b
Gene Name GSPT2
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Involved in translation termination in response to the termination codons UAA, UAG and UGA. May play a role as a potent stimulator of the release factor activity of ETF1. Exhibits GTPase activity, which is ribosome- and ETF1-dependent. May play a role in cell cycle progression
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GSPT2
Gene Sequence
>1887 bp
ATGGATTCGGGCAGCAGCAGCAGCGACTCGGCGCCCGATTGCTGGGACCAGGTGGACATG
GAATCCCCGGGGTCGGCCCCGAGCGGGGATGGAGTCTCCTCTGCGGTGGCCGAGGCCCAG
CGCGAGCCCCTCAGCTCGGCTTTCAGCCGTAAGCTCAACGTCAACGCCAAGCCCTTCGTG
CCTAACGTACACGCCGCGGAGTTCGTGCCGTCCTTCCTGCGGGGCCCGACTCAGCCGCCC
ACCCTCCCGGCCGGCTCCGGCAGCAACGATGAAACCTGCACCGGCGCGGGATACCCTCAA
GGTAAAAGGATGGGACGGGGGGCACCTGTGGAACCTTCCCGAGAGGAACCGTTAGTGTCG
CTTGAAGGTTCCAATTCAGCCGTTACCATGGAACTTTCAGAACCTGTTGTAGAAAATGGA
GAGGTGGAAATGGCCCTAGAAGAATCATGGGAGCACAGTAAAGAAGTAAGTGAAGCCGAG
CCTGGGGGTGGTTCCTCGGGAGATTCAGGGCCCCCAGAAGAAAGTGGCCAGGAAATGATG
GAGGAAAAAGAGGAAATAAGAAAATCCAAATCTGTGATCGTACCCTCAGGTGCACCTAAG
AAAGAACACGTAAATGTAGTATTCATTGGCCATGTAGACGCTGGCAAGTCAACCATCGGA
GGACAGATAATGTTTTTGACTGGAATGGTTGACAAAAGAACACTGGAGAAATATGAAAGA
GAAGCTAAGGAAAAAAACAGAGAAACCTGGTATTTGTCCTGGGCCTTAGATACAAATCAG
GAGGAACGAGACAAGGGTAAAACAGTCGAAGTGGGTCGTGCCTATTTTGAAACAGAAAGG
AAACATTTCACAATTTTAGATGCCCCTGGCCACAAGAGTTTTGTCCCAAATATGATTGGT
GGTGCTTCTCAAGCTGATTTGGCTGTGCTGGTCATCTCTGCCAGGAAAGGAGAGTTTGAA
ACTGGATTTGAAAAAGGTGGACAGACAAGAGAACATGCGATGTTGGCAAAAACGGCAGGG
GTAAAACATTTAATAGTGCTTATTAATAAGATGGATGATCCCACAGTAAATTGGAGCATC
GAGAGATATGAAGAATGTAAAGAAAAACTGGTGCCCTTTTTGAAAAAAGTAGGCTTCAGT
CCAAAAAAGGACATTCACTTTATGCCCTGCTCAGGACTGACCGGAGCAAATATTAAAGAG
CAGTCAGATTTCTGCCCTTGGTACACTGGATTACCATTTATTCCGTATTTGGATAACTTG
CCAAACTTCAACAGATCAATTGATGGACCAATAAGACTGCCAATTGTGGATAAGTACAAA
GATATGGGCACCGTGGTCCTGGGAAAGCTGGAATCCGGGTCCATTTTTAAAGGCCAGCAG
CTCGTGATGATGCCAAACAAGCACAATGTAGAAGTTCTTGGAATACTTTCTGATGATACT
GAAACTGATTTTGTAGCCCCAGGTGAAAACCTCAAAATCAGACTGAAGGGAATTGAAGAA
GAAGAGATTCTTCCAGGATTCATACTTTGTGATCCTAGTAACCTCTGCCATTCTGGACGC
ACGTTTGATGTTCAGATAGTGATTATTGAGCACAAATCCATCATCTGCCCAGGTTATAAT
GCGGTGCTGCACATTCATACTTGTATTGAGGAAGTTGAGATAACAGCGTTAATCTCCTTG
GTAGACAAAAAATCAGGAGAAAAAAGTAAGACACGACCCCGCTTCGTGAAACAAGATCAA
GTATGCATTGCTCGTTTAAGGACAGCAGGAACCATCTGCCTCGAGACGTTCAAAGATTTT
CCTCAGATGGGTCGTTTTACTTTAAGAGATGAGGGTAAGACCATTGCAATTGGAAAAGTT
CTGAAATTGGTCCCAGAGAAGGACTAA
Protein Properties
Number of Residues 628
Molecular Weight 68882.7
Theoretical pI 5.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
MDSGSSSSDSAPDCWDQVDMESPGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFV
PNVHAAEFVPSFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVS
LEGSNSAVTMELSEPVVENGEVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMM
EEKEEIRKSKSVIVPSGAPKKEHVNVVFIGHVDAGKSTIGGQIMFLTGMVDKRTLEKYER
EAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETERKHFTILDAPGHKSFVPNMIG
GASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSI
ERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNL
PNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDT
ETDFVAPGENLKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYN
AVLHIHTCIEEVEITALISLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDF
PQMGRFTLRDEGKTIAIGKVLKLVPEKD
GenBank ID Protein 7799910
UniProtKB/Swiss-Prot ID Q8IYD1
UniProtKB/Swiss-Prot Entry Name ERF3B_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ251548
GeneCard ID GSPT2
GenAtlas ID GSPT2
HGNC ID HGNC:4622
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  5. Yamashita A, Izumi N, Kashima I, Ohnishi T, Saari B, Katsuhata Y, Muramatsu R, Morita T, Iwamatsu A, Hachiya T, Kurata R, Hirano H, Anderson P, Ohno S: SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay. Genes Dev. 2009 May 1;23(9):1091-105. doi: 10.1101/gad.1767209. [PubMed:19417104 ]
  6. Jakobsen CG, Segaard TM, Jean-Jean O, Frolova L, Justesen J: [Identification of a novel termination release factor eRF3b expressing the eRF3 activity in vitro and in vivo]. Mol Biol (Mosk). 2001 Jul-Aug;35(4):672-81. [PubMed:11524954 ]
  7. Chauvin C, Salhi S, Le Goff C, Viranaicken W, Diop D, Jean-Jean O: Involvement of human release factors eRF3a and eRF3b in translation termination and regulation of the termination complex formation. Mol Cell Biol. 2005 Jul;25(14):5801-11. [PubMed:15987998 ]
  8. Groene J, Mansmann U, Meister R, Staub E, Roepcke S, Heinze M, Klaman I, Brummendorf T, Hermann K, Loddenkemper C, Pilarsky C, Mann B, Adams HP, Buhr HJ, Rosenthal A: Transcriptional census of 36 microdissected colorectal cancers yields a gene signature to distinguish UICC II and III. Int J Cancer. 2006 Oct 15;119(8):1829-36. [PubMed:16721809 ]
  9. Chauvin C, Salhi S, Jean-Jean O: Human eukaryotic release factor 3a depletion causes cell cycle arrest at G1 phase through inhibition of the mTOR pathway. Mol Cell Biol. 2007 Aug;27(16):5619-29. Epub 2007 Jun 11. [PubMed:17562865 ]