You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08385
Secondary Accession Numbers
  • 14097
Name Exocyst complex component 2
Synonyms
  1. Exocyst complex component Sec5
Gene Name EXOC2
Protein Type Unknown
Biological Properties
General Function Involved in exocytosis
Specific Function Component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:6
Locus 6p25.3
SNPs EXOC2
Gene Sequence
>2775 bp
ATGTCTCGATCACGACAACCCCCCCTTGTGACCGGCATCTCTCCAAATGAAGGGATACCA
TGGACGAAGGTCACAATCAGGGGAGAAAATCTGGGGACTGGCCCCACCGACCTCATAGGC
TTGACCATTTGTGGACATAATTGCCTCCTGACGGCAGAATGGATGTCTGCAAGTAAAATA
GTATGTCGAGTGGGACAAGCCAAAAATGACAAAGGAGACATTATTGTCACCACTAAGTCA
GGTGGCAGAGGAACCTCAACAGTCTCTTTCAAGCTACTCAAACCTGAGAAAATAGGCATT
TTGGATCAGTCTGCTGTGTGGGTTGATGAAATGAATTATTATGATATGCGCACTGACAGG
AACAAAGGAATTCCGCCCTTGTCCTTACGTCCTGCTAACCCGCTTGGCATTGAGATTGAA
AAAAGTAAATTTTCGCAGAAGGACTTAGAAATGCTATTCCATGGAATGAGTGCTGATTTT
ACAAGTGAGAATTTCTCAGCAGCCTGGTATCTTATAGAGAATCACTCAAACACCAGTTTT
GAGCAGCTCAAAATGGCAGTCACCAACCTAAAGAGACAGGCTAACAAGAAGAGTGAGGGC
AGCCTGGCCTATGTGAAAGGCGGTCTCAGTACATTCTTCGAAGCACAGGATGCCCTCTCA
GCCATCCATCAAAAACTAGAAGCAGATGGAACGGAAAAAGTAGAAGGATCCATGACGCAG
AAACTGGAGAATGTTCTGAACAGAGCAAGTAATACTGCAGACACATTGTTTCAAGAAGTA
TTAGGTCGGAAAGACAAGGCAGATTCCACTAGAAATGCACTCAATGTGCTTCAGCGATTT
AAGTTTCTTTTCAACCTTCCTCTAAATATTGAAAGGAATATTCAAAAGGGTGATTATGAT
GTGGTTATTAATGATTATGAAAAGGCCAAGTCACTTTTTGGGAAAACGGAGGTGCAAGTT
TTCAAGAAATATTATGCTGAAGTAGAAACAAGGATTGAAGCTTTAAGAGAATTACTTCTG
GATAAATTGCTTGAGACACCATCAACTTTACATGACCAAAAACGTTACATAAGGTACCTG
TCTGACCTTCATGCGTCTGGTGACCCTGCTTGGCAATGCATTGGAGCCCAACACAAGTGG
ATCCTTCAGCTCATGCACAGTTGCAAAGAGGGCTACGTGAAAGATCTGAAAGGTAACCCA
GGCCTGCACAGTCCCATGTTGGATCTTGATAATGATACACGTCCCTCAGTGTTGGGCCAT
CTCAGTCAGACAGCGTCCCTGAAGAGGGGCAGCAGCTTTCAGTCTGGTCGAGACGACACG
TGGAGATACAAAACTCCCCACAGGGTGGCCTTTGTTGAAAAATTGACAAAACTCGTCTTG
AGCCAGCTGCCTAACTTCTGGAAACTCTGGATCTCCTACGTTAATGGAAGCCTCTTCAGT
GAGACTGCTGAGAAGTCAGGCCAGATTGAAAGATCAAAGAATGTAAGGCAAAGACAAAAT
GATTTTAAGAAAATGATTCAGGAAGTAATGCACTCCCTGGTGAAGCTTACCCGCGGAGCC
CTGCTTCCCCTCAGCATCCGGGATGGGGAAGCCAAGCAGTACGGAGGCTGGGAGGTGAAG
TGCGAGCTCTCCGGACAGTGGCTCGCTCACGCCATCCAGACTGTAAGACTTACTCATGAA
TCGTTGACTGCCCTTGAAATTCCTAATGACCTGTTACAGACTATCCAGGATCTCATCTTG
GATCTCCGAGTACGTTGCGTAATGGCCACGTTGCAGCACACGGCGGAAGAAATAAAGAGA
TTAGCTGAAAAAGAAGACTGGATTGTTGACAATGAAGGACTGACTTCTCTACCATGTCAG
TTTGAACAGTGCATCGTGTGTTCTCTGCAGTCACTGAAGGGGGTTCTGGAGTGCAAGCCG
GGAGAGGCCAGTGTCTTCCAACAACCTAAAACACAGGAGGAGGTTTGCCAGCTAAGCATC
AATATAATGCAGGTTTTTATATACTGTCTGGAACAGTTGAGCACCAAGCCTGATGCAGAT
ATAGATACTACACATCTCTCTGTTGATGTTTCTTCCCCTGACTTGTTTGGAAGTATCCAT
GAAGACTTCAGCTTGACCTCAGAACAGCGCCTTTTGATAGTCCTAAGTAATTGCTGCTAT
CTAGAACGTCACACCTTCCTAAATATCGCAGAACATTTTGAAAAGCACAACTTCCAGGGA
ATAGAAAAAATCACACAGGTTAGCATGGCCTCATTGAAAGAACTAGATCAAAGACTCTTT
GAAAATTACATCGAGTTGAAAGCAGATCCCATCGTTGGCTCCTTAGAACCTGGAATTTAT
GCAGGATATTTTGATTGGAAGGACTGCCTGCCTCCAACAGGTGTCAGAAACTATTTAAAA
GAAGCACTGGTGAATATAATTGCCGTGCATGCAGAGGTGTTCACCATTTCCAAAGAACTG
GTCCCTCGGGTACTATCCAAGGTGATAGAAGCAGTTTCTGAAGAGCTCAGTCGACTGATG
CAGTGTGTTTCATCCTTCAGCAAAAATGGAGCTTTACAGGCGAGACTTGAAATCTGTGCT
TTGAGGGACACTGTGGCTGTTTACCTGACACCCGAAAGCAAGTCAAGTTTTAAGCAGGCT
TTGGAAGCCCTGCCCCAGCTTTCCAGTGGAGCAGATAAAAAGTTACTGGAAGAGCTCCTG
AACAAGTTCAAGAGTAGCATGCACTTGCAGCTCACCTGTTTCCAAGCAGCTTCTTCAACC
ATGATGAAAACATAA
Protein Properties
Number of Residues 924
Molecular Weight 104065.3
Theoretical pI 6.89
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exocyst complex component 2
MSRSRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTSENFSAAWYLIENHSNTSF
EQLKMAVTNLKRQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHASGDPAWQCIGAQHKWILQLMHSCKEGYVKDLKGNPGLHSPMLDLDNDTRPSVLGH
LSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKLTKLVLSQLPNFWKLWISYVNGSLFS
ETAEKSGQIERSKNVRQRQNDFKKMIQEVMHSLVKLTRGALLPLSIRDGEAKQYGGWEVK
CELSGQWLAHAIQTVRLTHESLTALEIPNDLLQTIQDLILDLRVRCVMATLQHTAEEIKR
LAEKEDWIVDNEGLTSLPCQFEQCIVCSLQSLKGVLECKPGEASVFQQPKTQEEVCQLSI
NIMQVFIYCLEQLSTKPDADIDTTHLSVDVSSPDLFGSIHEDFSLTSEQRLLIVLSNCCY
LERHTFLNIAEHFEKHNFQGIEKITQVSMASLKELDQRLFENYIELKADPIVGSLEPGIY
AGYFDWKDCLPPTGVRNYLKEALVNIIAVHAEVFTISKELVPRVLSKVIEAVSEELSRLM
QCVSSFSKNGALQARLEICALRDTVAVYLTPESKSSFKQALEALPQLSSGADKKLLEELL
NKFKSSMHLQLTCFQAASSTMMKT
GenBank ID Protein 15982242
UniProtKB/Swiss-Prot ID Q96KP1
UniProtKB/Swiss-Prot Entry Name EXOC2_HUMAN
PDB IDs
GenBank Gene ID AJ414403
GeneCard ID EXOC2
GenAtlas ID EXOC2
HGNC ID HGNC:24968
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Sjolinder M, Uhlmann J, Ponstingl H: DelGEF, a homologue of the Ran guanine nucleotide exchange factor RanGEF, binds to the exocyst component Sec5 and modulates secretion. FEBS Lett. 2002 Dec 4;532(1-2):211-5. [PubMed:12459492 ]
  8. Fenwick RB, Prasannan S, Campbell LJ, Nietlispach D, Evetts KA, Camonis J, Mott HR, Owen D: Solution structure and dynamics of the small GTPase RalB in its active conformation: significance for effector protein binding. Biochemistry. 2009 Mar 17;48(10):2192-206. doi: 10.1021/bi802129d. [PubMed:19166349 ]