Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08386
Secondary Accession Numbers
  • 14098
Name Exocyst complex component 7
Synonyms
  1. Exocyst complex component Exo70
Gene Name EXOC7
Protein Type Unknown
Biological Properties
General Function Involved in exocytosis
Specific Function Component of the exocyst complex involved in the docking of exocystic vesicles with fusion sites on the plasma membrane. In adipocytes, plays a crucial role in targeting SLC2A4 vesicle to the plasma membrane in response to insulin, perhaps directing the vesicle to the precise site of fusion
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
exocyst
Process
establishment of localization
transport
exocytosis
vesicle-mediated transport
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Peripheral membrane protein
  4. cytosol
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.1
SNPs EXOC7
Gene Sequence
>2208 bp
ATGATTCCCCCACAGGAGGCATCCGCTCGACGGCGGGAGATTGAGGACAAGCTGAAGCAG
GAGGAGGAGACTCTGTCCTTCATCCGAGACAGCCTGGAGAAGAGCGACCAGCTCACTAAG
AACATGGTGTCTATCTTATCATCCTTTGAGAGCCGCCTTATGAAGCTGGAGAACTCCATC
ATCCCTGTGCACAAGCAGACGGAGAATCTGCAGCGGCTGCAGGAGAATGTTGAGAAGACG
CTGTCCTGCCTGGACCATGTCATCAGCTACTACCATGTGGCCAGTGACACTGAGAAGATC
ATCAGAGAGGGCCCCACAGGTAGGCTGGAAGAGTACCTGGGAAGCATGGCCAAGATTCAG
AAGGCAGTGGAGTATTTCCAGGACAACAGCCCAGACAGCCCGGAACTCAACAAAGTGAAA
CTGCTCTTTGAGCGCGGGAAGGAGGCCCTGGAGTCCGAATTTCGCAGCCTGATGACGCGG
CACAGTAAGGTCGTCTCGCCCGTGCTCATCTTGGATCTGATCAGTGGTGACGATGATCTG
GAGGCCCAGGAGGACGTGACCCTGGAGCACCTGCCCGAGAGCGTGCTCCAGGATGTCATT
CGCATCTCCCGCTGGCTGGTGGAATATGGCCGCAACCAAGATTTCATGAACGTCTACTAC
CAGATACGCTCCAGCCAGCTGGACCGCTCCATCAAAGGACTGAAGGAGCATTTCCATAAG
AGCAGTTCTTCCTCTGGGGTTCCCTACTCCCCTGCTATCCCCAACAAGAGGAAAGACACA
CCTACCAAGAAGCCAGTCAAGCGGCCAGGGACGATCCGTAAGGCTCAGAACCTTCTGAAA
CAGTATTCCCAGCATGGTCTAGATGGGAAAAAGGGGGGCTCTAACCTCATTCCTCTGGAA
GGGCTTCTTCCCTGTACCCCAAGGGGCGGCCTGCCTGGCCCCTGGATAAACGCTGCTTGT
GTTTGTGCGGCCGACATCTCGCCAGGTCACGAGCATGATTTCCGAGTTAAGCACCTGTCC
GAGGCCTTGAACGACAAGCACGGGCCGCTGGCCGGGAGAGATGACATGCTGGACGTGGAG
ACCGATGCCTACATCCACTGCGTCAGTGCCTTCGTCAAGCTGGCGCAGAGCGAGTACCAG
CTGCTGGCCGACATCATCCCCGAGCACCACCAGAAGAAGACCTTCGACTCCCTGATACAG
GATGCCCTGGATGGGCTGATGCTTGAAGGGGAGAACATCGTGTCTGCTGCCCGGAAGGCC
ATTGTGCGACACGACTTCTCCACGGTGCTCACCGTCTTCCCCATCCTGCGACACCTCAAG
CAGACCAAGCCTGAGTTTGACCAGGTGCTCCAGGGCACGGCTGCCAGCACAAAGAACAAG
CTGCCTGGCCTCATCACATCCATGGAGACCATCGGTGCCAAAGCGCTGGAGGACTTCGCA
GACAACATCAAGAATGACCCGGACAAGGAGTACAACATGCCGAAGGACGGCACCGTACAC
GAGCTCACCAGCAATGCCATCCTCTTCCTGCAGCAGCTTTTGGACTTCCAGGAGACGGCA
GGCGCCATGCTGGCCTCCCAAGAGACCAGCTCTTCGGCCACCAGCTACAGCTCTGAGTTC
AGCAAGCGGCTGCTAAGCACCTATATCTGTAAAGTGCTGGGCAACCTGCAGTTGAACTTG
CTGAGCAAGTCCAAGGTGTACGAGGACCCAGCTCTGAGCGCCATCTTCCTGCACAACAAC
TACAATTACATCCTCAAGTCCCTGGAGAAGTCTGAACTGATCCAGCTGGTGGCAGTGACA
CAGAAGACTGCTGAGCGCTCCTACCGGGAGCACATTGAGCAGCAGATCCAGACCTACCAG
CGCAGCTGGTTAAAGGTGACTGATTACATCGCAGAGAAGAATCTACCTGTGTTCCAGCCG
GGAGTCAAGCTCCGGGACAAGGAGCGGCAGATTATCAAGGAGCGTTTTAAGGGCTTCAAT
GATGGCCTCGAAGAACTGTGCAAAATCCAGAAGGCCTGGGCTATTCCAGACACAGAGCAG
AGGGACAGGATTCGCCAGGCCCAGAAGACCATTGTCAAGGAGACCTACGGGGCCTTTCTA
CAGAAGTTTGGCAGCGTGCCCTTCACCAAGAACCCGGAGAAGTACATCAAGTACGGGGTG
GAGCAGGTGGGCGACATGATCGATCGCCTTTTCGACACCTCTGCCTGA
Protein Properties
Number of Residues 735
Molecular Weight 83381.2
Theoretical pI 6.77
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Exocyst complex component 7
MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSI
IPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQ
KAVEYFQDNSPDSPELNKVKLLFERGKEALESEFRSLMTRHSKVVSPVLILDLISGDDDL
EAQEDVTLEHLPESVLQDVIRISRWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFHK
SSSSSGVPYSPAIPNKRKDTPTKKPVKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLE
GLLPCTPRGGLPGPWINAACVCAADISPGHEHDFRVKHLSEALNDKHGPLAGRDDMLDVE
TDAYIHCVSAFVKLAQSEYQLLADIIPEHHQKKTFDSLIQDALDGLMLEGENIVSAARKA
IVRHDFSTVLTVFPILRHLKQTKPEFDQVLQGTAASTKNKLPGLITSMETIGAKALEDFA
DNIKNDPDKEYNMPKDGTVHELTSNAILFLQQLLDFQETAGAMLASQETSSSATSYSSEF
SKRLLSTYICKVLGNLQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVT
QKTAERSYREHIEQQIQTYQRSWLKVTDYIAEKNLPVFQPGVKLRDKERQIIKERFKGFN
DGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGV
EQVGDMIDRLFDTSA
GenBank ID Protein 223718046
UniProtKB/Swiss-Prot ID Q9UPT5
UniProtKB/Swiss-Prot Entry Name EXOC7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001145297.2
GeneCard ID EXOC7
GenAtlas ID EXOC7
HGNC ID HGNC:23214
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. [PubMed:10470851 ]
  7. Fielding AB, Schonteich E, Matheson J, Wilson G, Yu X, Hickson GR, Srivastava S, Baldwin SA, Prekeris R, Gould GW: Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis. EMBO J. 2005 Oct 5;24(19):3389-99. Epub 2005 Sep 8. [PubMed:16148947 ]