Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08394
Secondary Accession Numbers
  • 14106
Name FYVE, RhoGEF and PH domain-containing protein 5
Synonyms
  1. Zinc finger FYVE domain-containing protein 23
Gene Name FGD5
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function May activate CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. May play a role in regulating the actin cytoskeleton and cell shape
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
ion binding
cation binding
metal ion binding
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
transition metal ion binding
zinc ion binding
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location
  1. Cytoplasm
  2. Cytoplasm (Probable)
  3. cytoskeleton (Probable)
Gene Properties
Chromosome Location Chromosome:3
Locus 3p25.1
SNPs FGD5
Gene Sequence
>4389 bp
ATGTTCAGGGGTCCGAAGCCCCCCATTGCCCCCAAGCCCAGGCTGACTGCCCCAAACGAG
TGGAGAGCCAGTGTGTACCTGAATGACAGCTTGAACAAATGCAGCAACGGGCGGCTGCCC
TGTGTAGACAGGGGGCTTGATGAGGGGCCCCGGTCCATCCCAAAGTGCTCTGAGTCGGAG
ACCGACGAGGATTACATCGTGGTCCCCAGGGTTCCGCTGAGGGAGGATGAACCCAAGGAC
GAGGGCAGTGTGGGGAACAAAGCCCTGGTGTCTCCCGAGTCCTCTGCGGAAGAGGAAGAG
GAGCGTGAAGAGGGAGGCGAGGCATGTGGCCTGGAGGGTACAGGAGCTGGTGAGGATTCA
GTGGCCCCTGCTGCTCCGGGTGCAGGAGCGCTGAGCAGGGAGGGTGAGGAAGGCACAGAC
CTTGCTCTTGAGGATGAAGGGGAGGGCTGCGCTGATGAGCCAGGGACACTGGAGCAGGTG
TCCAGAAGTGAGGAGGAAGAGAAGCTAGTGCAGCCACACAGGGAGTGCAGCCTGGAGGAC
AGTGGGCCTTGGGCTGGAGAGGGGGTCTTCCAGAGCGACCTCCTCCTGCCTCACATCCAT
GGAGAGGACCAGGAGCCCCCCGACACCCCCGGGGAGGCAGAGGAGGATGATGAGGAAGGC
TGTGCCAGCACAGACCCAGCAGGGGCAGATGAGGGTTCGGGTCCTGACAGGCCCACGGAG
GACATGGGACAGGATGCTGAGGACACCAGTGAGGAGCCCCCTGAGAAGGAGGAGCTGGCC
GGGGTCCAGGAGGCAGAGACAGCCACAGACTGCCCTGAAGTTCTTGAGGAGGGATGTGAA
GAGGCCACGGGTGTCACAGGTGGGGAACAGGTTGACCTCAGTGAACCACCTGACCACGAG
AAGAAAACCAACCAAGAAGTGGCAGCCGCCACCCTGGAGGACCATGCACAGGATGAGTCC
GCCGAGGAGAGCTGCCAGATTGTCCCTTTTGAGAATGACTGCATGGAGGACTTCGTGACT
TCCCTCACAGGAAGCCCCTATGAGTTCTTCCCAACTGAGAGCACCTCTTTTTGCAGCGAG
AGCTGTTCTCCTCTTTCTGAATCAGCGAAAGGTTTAGAATCAGAGCAGGCACCAAAGCTG
GGGCTGCGTGCGGAGGAGAACCCCATGGTGGGGGCTTTGTGTGGCCAGTGTGGCTCCCTA
CAGGGTGGAGCGGCCGAGGGTCCCGCAGCCCCTGATGTGGTGGTCGTGCTGGAGGAGGAG
GCCTTGGATGATGCACTGGCCAACCCCTATGTGATGGGAGTGGGCCTGCCCGGTCAGGCG
GCCCCTGGAGAAGGAGGGCAGGCTGCATCGGACGCCCTGGGTGGTTATGGCTCGAAAGAA
GAATTGAACTGTGAGGCAGAGGGTGGCCTGGTTCCCGCGGACAGGAAGAACACCAGCACG
AGGGTCCGGCCCCACTCTGGGAAGGTGGCCGGCTATGTCCCAGAAACCGTCCCTGAAGAA
ACCGGACCTGAGGCGGGCTCGTCAGCCCCTGGCATTGGAGGTGCCGCAGAGGAGGTGGGA
AAGACGCTTTTGTCATTGGAGGGGAAGCCCTTGGAAGCCAGCAGGGCCTTGCCAGCAAAG
CCCAGGGCCTTTACTTTATACCCTCGGTCGTTCTCCGTGGAAGGCCGAGAGATTCCAGTG
TCCGTGTACCAGGAGCCTGAGGGGTCAGGGTTGGATGACCACAGGATAAAGAGGAAAGAG
GACAATCTCTCTCTGTCGTGTGTAATTGGCTCCTCTGGGAGTTTCTCCCAGAGAAACCAC
CTTCCGTCCAGCGGCACCTCCACGCCTTCTTCCATGGTCGACATCCCACCTCCTTTCGAC
CTGGCCTGCATCACCAAGAAGCCCATCACAAAGAGCTCTCCCTCACTCCTGATCGAGAGC
GACTCCCCGGACAAGTACAAGAAGAAGAAGTCATCCTTTAAGCGCTTCCTGGCACTGACG
TTTAAGAAGAAGACGGAGAACAAATTGCATGTGGATGTGAACGTGTCTTCCTCTAGGTCC
TCTTCAGAGTCCAGCTACCACGGGCCTTCCAGGATTCTGGAAGTTGACCGGAGAAGCCTC
AGCAACTCCCCTCAGCTTAAGTCTCGGACTGGGAAGCTCCGGGCTTCTGAATCCCCCTCC
TCCCTCATCTTTTATAGAGATGGCAAGAGGAAAGGTGTCCCCTTCAGCAGGACGGTGTCC
AGAGTGGAGTCCTTTGAAGACCGCTCCCGGCCGCCCTTCCTGCCCTTGCCACTGACCAAG
CCACGGTCCATCTCCTTCCCCAGCGCTGACACTTCAGACTATGAGAACATTCCAGCCATG
AACTCGGACTATGAGAATATCCAGATTCCACCCCGGAGACCTGCCAGGGCTGGCGCGTTC
ACGAAGCTGTTTGAAGATCAGAGCAGAGCCCTGTCCACAGCAAACGAAAATGATGGCTAC
GTGGACATGAGCAGCTTCAACGCCTTTGAGAGCAAACAGCAGAGTGCAGACCAGGACGCA
GAAAGCGCCTACACAGAGCCCTACAAAGTCTGTCCCATCTCGTCGGCAGCCCCCAAAGAG
GACCTTACGTCGGATGAAGAGCAGAGAAGCTCGGAGGAGGAGGACAGTGCTTCAAGAGAC
CCCAGTGTCACCCACAAGGTGGAAGGACAGTCCAGAGCCCTTGTCATCGCACAGGAACTG
CTATCTTCAGAGAAAGCATACGTGGAGATGCTCCAGCACTTAAATCTGGATTTCCATGGA
GCTGTCATGAGGGCCTTGGATGACATGGACCATGAAGGCAGAGACACATTGGCCCGGGAG
GAGCTGAGGCAGGGCCTGAGTGAACTCCCAGCCATCCACGACCTTCATCAAGGCATCCTG
GAGGAGCTGGAGGAAAGGCTGTCAAATTGGGAGAGCCAGCAGAAGGTAGCTGACGTCTTC
CTGGCCCGGGAGCAGGGGTTTGATCACCACGCCACTCACATCCTGCAGTTCGACAGGTAC
CTAGGTCTGCTCAGTGAGAATTGCCTCCACTCTCCCCGGCTGGCAGCTGCTGTCCGTGAA
TTTGAGCAGAGTGTACAAGGAGGCAGCCAGACTGCGAAGCATCGGCTGCTGCGGGTGGTT
CAACGCCTCTTCCAGTACCAAGTGCTCCTCACAGACTATTTAAACAACCTTTGTCCGGAC
TCCGCCGAGTACGACAACACACAGGGTGCACTGAGCCTCATCTCCAAAGTCACAGACCGT
GCCAACGACAGCATGGAGCAAGGGGAAAACCTGCAGAAGCTGGTCCACATTGAGCACAGC
GTCCGGGGCCAAGGGGATCTCCTCCAGCCAGGAAGGGAGTTTCTGAAGGAAGGGACGCTG
ATGAAAGTAACAGGGAAAAACAGACGGCCCCGGCACCTATTTCTGATGAACGATGTGCTC
CTGTACACCTATCCCCAGAAGGATGGGAAGTACCGGCTGAAGAACACATTGGCTGTGGCC
AACATGAAGGTCAGCCGCCCTGTGATGGAGAAAGTGCCCTACGCTCTAAAGATTGAGACT
TCCGAGTCCTGCCTGATGCTGTCTGCGAGCTCCTGTGCAGAGAGGGACGAGTGGTATGGC
TGTCTGAGCAGAGCCCTCCCTGAGGACTACAAGGCCCAGGCGCTGGCTGCATTCCACCAT
AGCGTGGAGATACGAGAGAGGCTGGGGGTTAGCCTTGGGGAGAGGCCCCCCACCCTGGTG
CCTGTCACACACGTCATGATGTGCATGAACTGCGGCTGCGACTTCTCCCTCACCCTGCGG
CGTCATCACTGTCACGCCTGTGGCAAGATCGTGTGCCGGAACTGTTCGCGGAACAAGTAC
CCGCTGAAGTACCTGAAGGACAGGATGGCCAAGGTCTGCGACGGCTGCTTCGGGGAGCTG
AAGAAGCGGGGCAGGGCTGTCCCGGGCCTGATGAGAGAGCGGCCTGTGAGCATGAGCTTC
CCGCTGTCTTCACCCCGCTTCTCGGGCAGTGCCTTTTCATCCGTCTTCCAGAGCATTAAC
CCCTCGACCTTCAAGAAGCAGAAGAAAGTCCCTTCAGCCCTGACAGAGGTGGCTGCCTCT
GGAGAGGGCTCTGCCATCAGTGGCTATCTCAGCCGGTGTAAGAGGGGCAAGCGGCACTGG
AAGAAGCTCTGGTTTGTCATCAAAGGCAAAGTTCTCTACACCTACATGGCCAGTGAGGAC
AAAGTGGCCTTGGAGAGTATGCCTCTGCTAGGCTTCACCATTGCTCCAGAAAAGGAAGAG
GGCAGCAGTGAAGTAGGACCTATTTTTCACCTTTACCACAAGAAAACCCTATTTTATAGC
TTCAAAGCAGAAGATACCAATTCAGCTCAGAGGTGGATCGAGGCCATGGAAGATGCGAGT
GTGTTATAG
Protein Properties
Number of Residues 1462
Molecular Weight 159889.4
Theoretical pI 4.66
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>FYVE, RhoGEF and PH domain-containing protein 5
MFRGPKPPIAPKPRLTAPNEWRASVYLNDSLNKCSNGRLPCVDRGLDEGPRSIPKCSESE
TDEDYIVVPRVPLREDEPKDEGSVGNKALVSPESSAEEEEEREEGGEACGLEGTGAGEDS
VAPAAPGAGALSREGEEGTDLALEDEGEGCADEPGTLEQVSRSEEEEKLVQPHRECSLED
SGPWAGEGVFQSDLLLPHIHGEDQEPPDTPGEAEEDDEEGCASTDPAGADEGSGPDRPTE
DMGQDAEDTSEEPPEKEELAGVQEAETATDCPEVLEEGCEEATGVTGGEQVDLSEPPDHE
KKTNQEVAAATLEDHAQDESAEESCQIVPFENDCMEDFVTSLTGSPYEFFPTESTSFCSE
SCSPLSESAKGLESEQAPKLGLRAEENPMVGALCGQCGSLQGGAAEGPAAPDVVVVLEEE
ALDDALANPYVMGVGLPGQAAPGEGGQAASDALGGYGSKEELNCEAEGGLVPADRKNTST
RVRPHSGKVAGYVPETVPEETGPEAGSSAPGIGGAAEEVGKTLLSLEGKPLEASRALPAK
PRAFTLYPRSFSVEGREIPVSVYQEPEGSGLDDHRIKRKEDNLSLSCVIGSSGSFSQRNH
LPSSGTSTPSSMVDIPPPFDLACITKKPITKSSPSLLIESDSPDKYKKKKSSFKRFLALT
FKKKTENKLHVDVNVSSSRSSSESSYHGPSRILEVDRRSLSNSPQLKSRTGKLRASESPS
SLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAM
NSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADQDA
ESAYTEPYKVCPISSAAPKEDLTSDEEQRSSEEEDSASRDPSVTHKVEGQSRALVIAQEL
LSSEKAYVEMLQHLNLDFHGAVMRALDDMDHEGRDTLAREELRQGLSELPAIHDLHQGIL
EELEERLSNWESQQKVADVFLAREQGFDHHATHILQFDRYLGLLSENCLHSPRLAAAVRE
FEQSVQGGSQTAKHRLLRVVQRLFQYQVLLTDYLNNLCPDSAEYDNTQGALSLISKVTDR
ANDSMEQGENLQKLVHIEHSVRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMNDVL
LYTYPQKDGKYRLKNTLAVANMKVSRPVMEKVPYALKIETSESCLMLSASSCAERDEWYG
CLSRALPEDYKAQALAAFHHSVEIRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLR
RHHCHACGKIVCRNCSRNKYPLKYLKDRMAKVCDGCFGELKKRGRAVPGLMRERPVSMSF
PLSSPRFSGSAFSSVFQSINPSTFKKQKKVPSALTEVAASGEGSAISGYLSRCKRGKRHW
KKLWFVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHKKTLFYS
FKAEDTNSAQRWIEAMEDASVL
GenBank ID Protein 194018497
UniProtKB/Swiss-Prot ID Q6ZNL6
UniProtKB/Swiss-Prot Entry Name FGD5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_152536.3
GeneCard ID FGD5
GenAtlas ID FGD5
HGNC ID HGNC:19117
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  5. Dias Neto E, Correa RG, Verjovski-Almeida S, Briones MR, Nagai MA, da Silva W Jr, Zago MA, Bordin S, Costa FF, Goldman GH, Carvalho AF, Matsukuma A, Baia GS, Simpson DH, Brunstein A, de Oliveira PS, Bucher P, Jongeneel CV, O'Hare MJ, Soares F, Brentani RR, Reis LF, de Souza SJ, Simpson AJ: Shotgun sequencing of the human transcriptome with ORF expressed sequence tags. Proc Natl Acad Sci U S A. 2000 Mar 28;97(7):3491-6. [PubMed:10737800 ]