You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08403
Secondary Accession Numbers
  • 14115
Name Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Synonyms
  1. BFA-resistant GEF 1
Gene Name GBF1
Protein Type Unknown
Biological Properties
General Function Involved in ARF guanyl-nucleotide exchange factor activity
Specific Function Promotes guanine-nucleotide exchange on ARF5. Promotes the activation of ARF5 through replacement of GDP with GTP
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
small gtpase regulator activity
enzyme regulator activity
arf guanyl-nucleotide exchange factor activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
biological regulation
regulation of biological process
regulation of arf protein signal transduction
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10q24
SNPs GBF1
Gene Sequence
>5580 bp
ATGGTGGATAAGAATATTTACATCATTCAAGGGGAGATTAACATTGTGGTTGGGGCCATC
AAACGAAATGCCCGATGGAGCACCCATACACCACTGGATGAAGAACGGGATCCTCTGCTG
CATAGTTTCGGTCATCTAAAGGAGGTTTTAAACAGTATAACAGAACTCTCAGAAATTGAG
CCCAATGTATTCCTTCGACCTTTTCTGGAAGTGATTCGCTCTGAAGATACCACTGGCCCT
ATCACTGGACTGGCACTCACCTCTGTCAACAAGTTCCTGTCCTATGCACTCATAGATCCC
ACCCATGAGGGCACAGCAGAGGGCATGGAGAACATGGCAGATGCTGTCACCCATGCTCGT
TTTGTGGGCACGGATCCTGCCAGTGATGAAGTTGTCCTGATGAAAATCCTTCAGGTTCTA
CGGACTCTGCTGCTAACCCCAGTGGGTGCCCACCTAACCAATGAATCTGTGTGTGAGATT
ATGCAGTCTTGCTTCCGGATCTGCTTTGAAATGAGGCTCAGTGAGTTATTGAGAAAATCC
GCAGAGCACACTCTCGTAGACATGGTGCAGCTGCTCTTCACAAGGTTACCTCAGTTTAAA
GAAGAACCCAAGAACTATGTGGGGACCAACATGAAGAAGCTGAAAATGAGAGCCGGAGGC
ATGAGTGATTCATCCAAATGGAAGAAACAGAAGAGATCCCCTCGGCCCCCACGCCATATG
ACCAAAGTCACACCAGGTTCAGAGCTGCCCACTCCCAATGGAACCACCTTATCATCTAAC
CTCACTGGTGGCATGCCCTTCATTGATGTGCCCACTCCCATCTCCTCTGCAAGTTCAGAA
GCTGCCTCAGCAGTGGTCAGTCCCTCTACAGACAGTGGCCTGGAATTCTCCTCCCAAACC
ACTTCCAAGGAAGACCTTACTGATCTAGAGCAACCTGGCTCTCCAGGGTACAGCACAGCT
ACAGAGCCTGGAAGCAGTGAGCTAGGTGTTCCCGAGCAGCCTGACCTCCAGGAAGGGACC
CATGTGGAAAAGTCCCAGTCAGCATCTGTGGAGTCCATCCCTGAAGTGTTAGAGGAGTGC
ACGTCCCCTGCCGACCACTCTGACTCTGCCTCTGTCCATGACATGGATTACGTCAATCCC
CGGGGCGTGCGCTTTACACAGTCCTCCCAGAAAGAAGGCACAGCTTTGGTCCCCTATGGT
CTTCCCTGCATCCGCGAGCTCTTCCGCTTCCTCATCTCCCTCACCAATCCACACGACCGC
CATAACTCAGAGGTTATGATTCACATGGGACTGCATTTGCTGACAGTGGCCCTTGAGTCA
GCCCCTGTAGCCCAGTGCCAGACCCTCTTGGGCCTCATCAAGGATGAGATGTGCCGTCAC
TTATTCCAGCTACTCAGCATAGAGCGACTAAACCTTTATGCTGCTTCCCTGCGAGTATGC
TTCCTACTGTTTGAGAGCATGCGAGAGCACCTCAAGTTCCAAATGGAGATGTACATCAAA
AAGCTTATGGAGATCATCACTGTGGAGAACCCCAAGATGCCTTATGAGATGAAGGAGATG
GCACTGGAGGCCATTGTGCAGCTCTGGCGCATCCCCAGCTTTGTCACAGAGCTCTACATC
AACTATGATTGTGACTACTACTGTTCCAACCTCTTTGAGGAACTCACAAAGCTGCTGTCC
AAGAATGCCTTCCCTGTGTCTGGTCAACTCTATACAACACACCTACTATCTCTTGATGCC
CTATTGACAGTGATTGACAGCACCGAGGCCCACTGCCAGGCTAAAGTCCTCAACAGCCTC
ACCCAGCAAGAGAAGAAGGAGACAGCCAGACCAAGCTGTGAGATAGTAGATGGCACCCGA
GAAGCTAGCAATACTGAGAGAACTGCCAGCGATGGGAAAGCTGTAGGCATGGCCTCAGAC
ATCCCAGGCCTGCATCTGCCAGGTGGAGGGCGGCTGCCACCAGAACATGGGAAATCAGGA
TGCAGTGATCTGGAGGAAGCTGTTGACTCTGGGGCTGACAAAAAGTTTGCCCGGAAGCCA
CCCCGATTTTCCTGTCTCCTGCCAGATCCACGGGAACTAATTGAAATTAAAAACAAAAAG
AAGCTGCTAATCACTGGCACAGAGCAGTTCAATCAGAAACCAAAGAAGGGGATTCAGTTT
CTGCAAGAGAAAGGCCTCCTCACCATCCCAATGGACAACACAGAGGTTGCTCAGTGGCTC
CGAGAGAACCCTCGGCTGGACAAGAAGATGATTGGAGAGTTTGTGAGTGACCGCAAAAAC
ATTGACCTGTTGGAGAGCTTTGTGAGCACCTTCAGTTTTCAGGGTCTGCGACTGGACGAA
GCCCTCCGCCTCTACCTGGAAGCCTTCCGTTTGCCTGGGGAAGCACCAGTCATCCAGAGG
TTGCTGGAGGCATTCACAGAGCGTTGGATGAATTGTAATGGCTCCCCATTTGCCAATAGC
GATGCCTGCTTTTCCCTGGCCTATGCTGTCATCATGCTTAATACTGACCAGCACAACCAC
AATGTTCGTAAACAGAATGCACCCATGACCCTGGAGGAGTTTCGCAAAAATCTGAAAGGT
GTGAATGGAGGCAAGGACTTTGAGCAAGACATCCTGGAGGACATGTACCATGCCATCAAG
AATGAGGAAATTGTAATGCCTGAGGAGCAGACAGGCTTGGTTCGGGAGAACTATGTGTGG
AATGTGCTGCTTCATCGAGGTGCCACCCCTGAGGGCATATTCCTGCGTGTGCCTACTGCC
AGCTATGATCTTGACCTCTTCACCATGACCTGGGGCCCCACTATTGCTGCTCTCTCTTAT
GTCTTTGACAAAAGCCTTGAGGAGACAATCATCCAGAAAGCCATCTCAGGCTTCAGGAAG
TGCGCCATGATCTCCGCCCACTATGGCCTCAGCGATGTGTTTGACAATCTCATCATCTCT
CTATGCAAATTCACAGCTCTCAGCAGTGAGTCTATTGAGAACCTGCCCAGTGTATTTGGA
AGCAACCCTAAAGCCCATATTGCAGCCAAGACAGTATTCCATTTGGCCCATCGTCATGGT
GACATCCTGCGGGAGGGCTGGAAGAATATCATGGAGGCCATGCTGCAGCTCTTCCGAGCC
CAACTACTGCCCAAGGCTATGATAGAGGTAGAAGATTTCGTGGATCCCAATGGCAAGATC
TCTCTACAGCGGGAAGAGACACCATCAAACCGAGGAGAGTCAACAGTGCTGAGCTTTGTG
AGCTGGCTAACACTGAGTGGTCCTGAGCAGTCTAGTGTTCGGGGCCCATCCACTGAAAAC
CAAGAGGCCAAGAGAGTGGCCTTAGAGTGTATAAAGCAATGTGACCCAGAAAAAATGATC
ACAGAAAGCAAGTTCCTCCAGCTGGAGTCACTACAGGAGCTCATGAAGGCTCTGGTCTCA
GTGACACCAGATGAAGAGACATATGATGAGGAAGATGCTGCTTTCTGCCTAGAGATGCTG
CTAAGGATTGTGTTGGAGAACAGGGATCGTGTGGGCTGTGTGTGGCAGACTGTTCGAGAC
CATCTATACCACCTCTGTGTTCAGGCACAAGATTTCTGCTTCCTTGTGGAGCGGGCAGTG
GTGGGGTTGCTACGCCTGGCCATTCGGCTTCTCCGGAGAGAAGAGATCAGTGCTCAGGTG
CTGCTCTCCCTGCGCATTTTGCTACTGATGAAGCCCAGTGTGCTATCCCGAGTCAGCCAC
CAGGTTGCGTATGGGCTCCATGAACTCCTGAAGACCAATGCAGCCAACATCCACTCAGGT
GATGACTGGGCCACACTCTTCACACTGCTGGAGTGCATCGGCTCAGGTGTGAAGCCTCCA
GCTGCTCTGCAGGCCACAGCCAGGGCAGATGCACCTGATGCCGGGGCCCAGTCAGATAGT
GAGCTCCCATCCTACCATCAGAATGACGTGAGCCTGGATCGAGGGTACACTTCCGACTCA
GAGGTCTACACTGACCATGGCAGGCCGGGCAAGATACACCGATCAGCCACAGATGCCGAT
GTGGTCAACAGTGGTTGGTTAGTGGTTGGGAAGGATGACGTTGATAACTCCAAGCCAGGG
CCCAGCCGCCCAGGCCCTTCACCCCTGATCAATCAATACAGCCTAACAGTGGGACTGGAT
TTGGGGCCACACGACACTAAGTCTCTGCTTAAGTGTGTGGAATCGCTGTCCTTCATCGTG
CGTGATGCTGCCCACATCACACCTGACAACTTTGAGCTCTGCGTCAAGACTCTCCGGATC
TTTGTGGAGGCCAGTCTGAATGGCGGATGCAAGTCCCAGGAGAAACGTGGCAAGAGTCAC
AAATATGACAGCAAAGGGAACCGCTTCAAGAAGAAATCCAAAGAGGGATCAATGCTTCGC
CGGCCTCGAACCTCCAGCCAACATGCCTCTCGGGGCGGGCAGAGTGATGATGATGAGGAC
GAAGGCGTGCCTGCCAGCTACCATACGGTGTCTTTACAGGTCAGTCAGGACTTGCTAGAC
CTGATGCACACCCTGCACACGCGGGCAGCCTCTATCTACAGCTCATGGGCGGAGGAGCAA
CGCCACCTGGAGACAGGTGGCCAGAAGATTGAAGCTGATTCTCGCACCCTCTGGGCCCAC
TGCTGGTGCCCTTTACTGCAGGGTATTGCCTGCCTGTGCTGCGATGCCCGGCGCCAGGTA
CGGATGCAGGCACTGACCTATCTGCAGCGAGCACTACTTGTACATGATCTGCAAAAGCTA
GATGCCCTGGAATGGGAGTCCTGTTTTAACAAGGTGCTGTTTCCTCTACTTACCAAGCTC
TTGGAGAACATCAGCCCTGCAGATGTGGGTGGGATGGAGGAGACCCGGATGAGGGCTTCC
ACATTGCTCTCTAAGGTCTTCCTGCAGCACCTGTCTCCACTGCTGTCACTCTCTACCTTT
GCGGCCCTCTGGCTCACCATCTTGGACTTCATGGACAAGTACATGCACGCAGGCTCCAGC
GACTTACTGTCAGAGGCGATCCCTGAGTCTCTGAAGAACATGCTTCTGGTGATGGACACA
GCGGAGATTTTCCACAGTGCAGATGCACGGGGAGGCGGCCCCTCGGCCCTCTGGGAGATC
ACCTGGGAACGCATTGACTGTTTTCTCCCTCACCTACGAGATGAACTCTTCAAGCAGACC
GTCATCCAGGACCCCATGCCCATGGAGCCTCAAGGCCAAAAGCCTCTCGCCTCAGCCCAC
CTGACTTCCGCTGCTGGCGACACTAGGACACCTGGCCATCCACCGCCCCCAGAGATTCCA
TCTGAGCTGGGGGCCTGTGACTTTGAGAAGCCCGAGAGCCCCCGAGCCGCCAGCAGCAGC
TCCCCAGGATCACCAGTGGCCTCAAGCCCCAGCAGGCTGAGCCCCACCCCCGACGGGCCT
CCACCCTTGGCTCAGCCCCCACTGATCCTGCAGCCCTTGGCCTCCCCACTGCAGGTGGGC
GTGCCACCTATGACTCTGCCCATCATCCTCAACCCTGCGCTCATCGAGGCCACCTCACCA
GTGCCCCTCCTGGCCACACCCCGCCCCACAGATCCCATACCCACCTCTGAGGTCAACTAA
Protein Properties
Number of Residues 1859
Molecular Weight 206443.8
Theoretical pI 5.5
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIE
PNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSYALIDPTHEGTAEGMENMADAVTHAR
FVGTDPASDEVVLMKILQVLRTLLLTPVGAHLTNESVCEIMQSCFRICFEMRLSELLRKS
AEHTLVDMVQLLFTRLPQFKEEPKNYVGTNMKKLKMRAGGMSDSSKWKKQKRSPRPPRHM
TKVTPGSELPTPNGTTLSSNLTGGMPFIDVPTPISSASSEAASAVVSPSTDSGLEFSSQT
TSKEDLTDLEQPGSPGYSTATEPGSSELGVPEQPDLQEGTHVEKSQSASVESIPEVLEEC
TSPADHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISLTNPHDR
HNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSIERLNLYAASLRVC
FLLFESMREHLKFQMEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSFVTELYI
NYDCDYYCSNLFEELTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQAKVLNSL
TQQEKKETARPSCEIVDGTREASNTERTASDGKAVGMASDIPGLHLPGGGRLPPEHGKSG
CSDLEEAVDSGADKKFARKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKPKKGIQF
LQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNIDLLESFVSTFSFQGLRLDE
ALRLYLEAFRLPGEAPVIQRLLEAFTERWMNCNGSPFANSDACFSLAYAVIMLNTDQHNH
NVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLVRENYVW
NVLLHRGATPEGIFLRVPTASYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKAISGFRK
CAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFHLAHRHG
DILREGWKNIMEAMLQLFRAQLLPKAMIEVEDFVDPNGKISLQREETPSNRGESTVLSFV
SWLTLSGPEQSSVRGPSTENQEAKRVALECIKQCDPEKMITESKFLQLESLQELMKALVS
VTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCFLVERAV
VGLLRLAIRLLRREEISAQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNAANIHSG
DDWATLFTLLECIGSGVKPPAALQATARADAPDAGAQSDSELPSYHQNDVSLDRGYTSDS
EVYTDHGRPGKIHRSATDADVVNSGWLVVGKDDVDNSKPGPSRPGPSPLINQYSLTVGLD
LGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSH
KYDSKGNRFKKKSKEGSMLRRPRTSSQHASRGGQSDDDEDEGVPASYHTVSLQVSQDLLD
LMHTLHTRAASIYSSWAEEQRHLETGGQKIEADSRTLWAHCWCPLLQGIACLCCDARRQV
RMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGMEETRMRAS
TLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAIPESLKNMLLVMDT
AEIFHSADARGGGPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPMEPQGQKPLASAH
LTSAAGDTRTPGHPPPPEIPSELGACDFEKPESPRAASSSSPGSPVASSPSRLSPTPDGP
PPLAQPPLILQPLASPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDPIPTSEVN
GenBank ID Protein 4321980
UniProtKB/Swiss-Prot ID Q92538
UniProtKB/Swiss-Prot Entry Name GBF1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF068755
GeneCard ID GBF1
GenAtlas ID GBF1
HGNC ID HGNC:4181
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  7. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  10. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  11. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502 ]
  12. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  13. Mansour SJ, Herbrick JA, Scherer SW, Melancon P: Human GBF1 is a ubiquitously expressed gene of the sec7 domain family mapping to 10q24. Genomics. 1998 Dec 1;54(2):323-7. [PubMed:9828135 ]