You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08418
Secondary Accession Numbers
  • 14130
Name Guanylate-binding protein 6
Synonyms
  1. GBP-6
  2. GTP-binding protein 6
  3. Guanine nucleotide-binding protein 6
Gene Name GBP6
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Binds GTP, GDP and GMP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.2
SNPs GBP6
Gene Sequence
>1902 bp
ATGGAATCTGGACCCAAAATGTTGGCCCCCGTTTGCCTGGTGGAAAATAACAATGAGCAG
CTATTGGTGAACCAGCAAGCTATACAGATTCTTGAAAAGATTTCTCAGCCAGTGGTGGTG
GTGGCCATTGTAGGACTGTACCGTACAGGGAAATCCTACTTGATGAACCATCTGGCAGGA
CAGAATCATGGCTTCCCTCTGGGCTCCACGGTGCAGTCTGAAACCAAGGGCATCTGGATG
TGGTGCGTGCCCCACCCATCCAAGCCAAACCACACCCTGGTCCTTCTGGACACCGAAGGT
CTGGGCGATGTGGAAAAGGGTGACCCTAAGAATGACTCCTGGATCTTTGCCCTGGCTGTG
CTCCTGTGCAGCACCTTTGTCTACAACAGCATGAGCACCATCAACCACCAGGCCCTGGAG
CAGCTGCATTATGTGACGGAGCTCACAGAACTAATTAAGGCAAAGTCCTCCCCAAGGCCT
GATGGAGTAGAAGATTCCACAGAGTTTGTGAGTTTCTTCCCAGACTTTCTTTGGACAGTA
CGGGATTTCACTCTGGAGCTGAAGTTGAACGGTCACCCTATCACAGAAGATGAATACCTG
GAGAATGCCTTGAAGCTGATTCAAGGCAATAATCCCAGAGTTCAAACATCCAATTTTCCC
AGGGAGTGCATCAGGCGTTTCTTTCCAAAACGGAAGTGTTTCGTCTTTGACCGGCCAACA
AATGACAAAGACCTTCTAGCCAATATTGAGAAGGTGTCAGAAAAGCAACTGGATCCCAAA
TTCCAGGAACAAACAAACATTTTCTGTTCTTACATCTTCACTCATGCAAGAACCAAGACC
CTCAGGGAGGGAATCACAGTCACTGGGAATCGTCTGGGAACTCTGGCAGTGACTTATGTA
GAGGCCATCAACAGTGGAGCAGTGCCTTGTCTGGAGAATGCAGTGATAACTCTGGCCCAG
CGTGAGAACTCAGCGGCCGTGCAGAGGGCAGCTGACTACTACAGCCAGCAGATGGCCCAG
CGAGTGAAGCTCCCCACAGACACGCTCCAGGAGCTGCTGGACATGCATGCGGCCTGTGAG
AGGGAAGCCATTGCAATCTTCATGGAGCACTCCTTCAAGGATGAAAATCAGGAATTCCAG
AAGAAGTTCATGGAAACCACAATGAATAAGAAGGGGGATTTCTTGCTGCAGAATGAAGAG
TCATCTGTTCAATACTGCCAGGCTAAACTCAATGAGCTCTCAAAGGGACTAATGGAAAGT
ATCTCAGCAGGAAGTTTCTCTGTTCCTGGAGGGCACAAGCTCTACATGGAAACAAAGGAA
AGGATTGAACAGGACTATTGGCAAGTTCCCAGGAAAGGAGTAAAGGCAAAAGAGGTCTTC
CAGAGGTTCCTGGAGTCACAGATGGTGATAGAGGAATCCATCTTGCAGTCAGATAAAGCC
CTCACTGATAGAGAGAAGGCAGTAGCAGTGGATCGGGCCAAGAAGGAGGCAGCTGAGAAG
GAACAGGAACTTTTAAAACAGAAATTACAGGAGCAGCAGCAACAGATGGAGGCTCAAGAT
AAGAGTCGCAAGGAAAACATAGCCCAACTGAAGGAGAAGCTGCAGATGGAGAGAGAACAC
CTACTGAGAGAGCAGATTATGATGTTGGAGCACACGCAGAAGGTCCAAAATGATTGGCTT
CATGAAGGATTTAAGAAGAAGTATGAGGAGATGAATGCAGAGATAAGTCAATTTAAACGT
ATGATTGATACTACAAAAAATGATGATACTCCCTGGATTGCACGAACCTTGGACAACCTT
GCCGATGAGCTAACTGCAATATTGTCTGCTCCTGCTAAATTAATTGGTCATGGTGTCAAA
GGTGTGAGCTCACTCTTTAAAAAGCATAAGCTCCCCTTTTAA
Protein Properties
Number of Residues 633
Molecular Weight 72426.3
Theoretical pI 6.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Guanylate-binding protein 6
MESGPKMLAPVCLVENNNEQLLVNQQAIQILEKISQPVVVVAIVGLYRTGKSYLMNHLAG
QNHGFPLGSTVQSETKGIWMWCVPHPSKPNHTLVLLDTEGLGDVEKGDPKNDSWIFALAV
LLCSTFVYNSMSTINHQALEQLHYVTELTELIKAKSSPRPDGVEDSTEFVSFFPDFLWTV
RDFTLELKLNGHPITEDEYLENALKLIQGNNPRVQTSNFPRECIRRFFPKRKCFVFDRPT
NDKDLLANIEKVSEKQLDPKFQEQTNIFCSYIFTHARTKTLREGITVTGNRLGTLAVTYV
EAINSGAVPCLENAVITLAQRENSAAVQRAADYYSQQMAQRVKLPTDTLQELLDMHAACE
REAIAIFMEHSFKDENQEFQKKFMETTMNKKGDFLLQNEESSVQYCQAKLNELSKGLMES
ISAGSFSVPGGHKLYMETKERIEQDYWQVPRKGVKAKEVFQRFLESQMVIEESILQSDKA
LTDREKAVAVDRAKKEAAEKEQELLKQKLQEQQQQMEAQDKSRKENIAQLKEKLQMEREH
LLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNL
ADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF
GenBank ID Protein 157671915
UniProtKB/Swiss-Prot ID Q6ZN66
UniProtKB/Swiss-Prot Entry Name GBP6_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_198460.2
GeneCard ID GBP6
GenAtlas ID GBP6
HGNC ID HGNC:25395
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]