You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08419
Secondary Accession Numbers
  • 14131
Name Guanylate-binding protein 7
Synonyms
  1. GBP-7
  2. GTP-binding protein 7
  3. Guanine nucleotide-binding protein 7
  4. Guanylate-binding protein 4-like
Gene Name GBP7
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Binds GTP, GDP and GMP
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 1p22.2
SNPs GBP7
Gene Sequence
>1917 bp
ATGGCATCAGAGATCCACATGCCAGGCCCAGTGTGCCTCACTGAGAACACTAAAGGGCAT
CTGGTGGTGAATTCAGAAGCTCTGGAAATCCTGTCTGCCATTACACAGCCTGTAGTAGTG
GTGGCAATTGTGGGCCTCTACCGCACAGGCAAATCCTACCTAATGAACAAGCTGGCTGGG
AAGAACAAAGGCTTCCCTCTGGGCTGCACAGTGAAGTCTGAAACCAAAGGCATCTGGATG
TGGTGTGTGCCCCACCCCTCCAAGCCAAACCACACCCTGATCCTTCTGGACACGGAGGGC
CTGGGTGATATGGAAAAGAGTGACCCTAAGAGTGACTCGTGGATCTTTGCCCTGGCTGTG
CTTCTAAGCAGCAGCTTTGTCTACAACAGCATGGGCACCATCAACCACCAGGCCCTGGAG
CAGCTGCACTACGTGACTGAGCTAACAGAGCTAATCAGGGCAAAATCGTGCCCCAGACCT
GATGAAGTTGAGGACTCCAGCGAGTTTGTGAGTTTCTTTCCAGACTTTATTTGGACTGTT
CGAGATTTTACCCTGGAGCTGAAGTTAGATGGACACCCCATCACAGAAGATGAGTACCTG
GAGAATGCCTTGAAGCTGATTTCAGGCAAGAATCCCCAAATCCAAAATTCTAACAAGCCC
AGGGAGTGGATCAGGCATTTCTTTCCAAAACAGAAGTGCTTTGTCTTTGACCGGCCAATA
AATGACAAAAAACTCTTACTCCATGTTGAAGAAGTACGAGAAGACCAACTGGATAGTAAT
TTCCAGATGCAATCAGAAAATTTCTGTTCTTATATCTTCACCCATGCAAAGACCAAGACC
CTGAGAGAGGGAATCCTTGTCACTGGAAACCGGCTGGGGATGCTGGTGGAGACCTACCTG
GATGCCATCAACAGTGGAGCGACTCCTTGTCTGGAGAATGCAATGGCAGTTCTGGCCCAG
TGTGAGAACTCAGCAGCCGTGCAGAGGGCAGCCAACCACTACAGCCAGCAGATGGCCCAG
CAAGTGAGATTCCCCACAGACACACTCCAGGAGCTGCTGGACGTGCATGCAGTTTGTGAG
AGGGAAGCCATTGCAGTCTTCATGGAGTACTCCTTCAAAGATAAAAGCCAGGAATTTCAG
AAGAAGCTTGTGGACACCATGGAGAAAAAGAAGGAAGACTTTGTGCTGCAGAATGAAGAG
GCATCTGCCAAATATTGTCAGGCTGAGCTTAAGCGGCTTTCAGAGCTCTTGACAGAAAGT
ATTTCAAGAGGAACTTTCTTTGTTCCGGGGGGGCACAATATCTACTTAGAAGCAAAAAAG
AAGATTGAACAGGACTATACACTAGTGCCCAGAAAAGGAGTTAAGGCAGACGAGGTCCTC
CAGAGCTTCCTGCAGTCACAGGTGGTTATAGAGGAATCCATCCTGCAGTCAGACAAAGCC
CTCACTGCTGGAGAGAAGGCCATAGCAGCTAAGCAGGCTAAGAAGGAGGCAGCTGAAAAG
GAACAGGAGCTGCTAAGACAAAAACAGAAGGAACAGCAGCAAATGATGGAGGCTCAAGAG
AGAAGTTTCCAGGAAAACATAGCTCAACTCAAGAAGAAGATGGAGAGGGAAAGGGAAAAC
TATATGAGAGAACTGAGAAAGATGTTGAGTCACAAGATGAAGGTCCTAGAAGAACTGCTT
ACTGAAGGATTTAAAGAGATATTTGAGTCGTTAAATGAAGAGATTAATCGACTGAAAGAA
CAAATTGAAGCAGCTGAAAATGAAGAGCCCTCAGTGTTTTCACAGATTCTTGATGTGGCT
GGCAGTATATTTATTGCAGCACTACCTGGGGCTGCTAAGCTAGTTGATTTAGGAATGAAA
ATTCTTAGCTCATTATGTAATAGGCTGAGAAATCCTGGTAAGAAAATTATAAGCTGA
Protein Properties
Number of Residues 638
Molecular Weight 72524.7
Theoretical pI 5.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 27-47
  • 114-134
Protein Sequence
>Guanylate-binding protein 7
MASEIHMPGPVCLIENTKGHLVVNSEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KNKGFPLGCTVKSETKGIWMWCVPHPSKPNHTLILLDTEGLGDMEKSDPKSDSWIFALAV
LLSSSFVYNSMGTINHQALEQLHYVTELTELIRAKSCPRPDEVEDSSEFVSFFPDFIWTV
RDFTLELKLDGHPITEDEYLENALKLISGKNPQIQNSNKPREWIRHFFPKQKCFVFDRPI
NDKKLLLHVEEVREDQLDSNFQMQSENFCSYIFTHAKTKTLREGILVTGNRLGMLVETYL
DAINSGATPCLENAMAVLAQCENSAAVQRAANHYSQQMAQQVRFPTDTLQELLDVHAVCE
REAIAVFMEYSFKDKSQEFQKKLVDTMEKKKEDFVLQNEEASAKYCQAELKRLSELLTES
ISRGTFFVPGGHNIYLEAKKKIEQDYTLVPRKGVKADEVLQSFLQSQVVIEESILQSDKA
LTAGEKAIAAKQAKKEAAEKEQELLRQKQKEQQQMMEAQERSFQENIAQLKKKMEREREN
YMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAAENEEPSVFSQILDVA
GSIFIAALPGAAKLVDLGMKILSSLCNRLRNPGKKIIS
GenBank ID Protein 148234215
UniProtKB/Swiss-Prot ID Q8N8V2
UniProtKB/Swiss-Prot Entry Name GBP7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_207398.2
GeneCard ID GBP7
GenAtlas ID GBP7
HGNC ID HGNC:29606
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]