Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08430
Secondary Accession Numbers
  • 14142
Name Ral guanine nucleotide dissociation stimulator
Synonyms
  1. Ral guanine nucleotide exchange factor
  2. RalGDS
  3. RalGEF
Gene Name RALGDS
Protein Type Unknown
Biological Properties
General Function Involved in signal transduction
Specific Function Stimulates the dissociation of GDP from the Ras-related RalA and RalB GTPases which allows GTP binding and activation of the GTPases. Interacts and acts as an effector molecule for R-Ras, H-Ras, K-Ras, and Rap
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular
Function
enzyme regulator activity
nucleoside-triphosphatase regulator activity
gtpase regulator activity
guanyl-nucleotide exchange factor activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
intracellular signal transduction
small gtpase mediated signal transduction
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.3
SNPs RALGDS
Gene Sequence
>2745 bp
ATGGTGCAGCGCATGTGGGCCGAGGCGGCCGGGCCTGCTGGCGGCGCCGAGCCGCTGTTT
CCGGGCTCCCGGCGGAGCCGCAGCGTGTGGGACGCCGTGCGCCTGGAGGTGGGCGTCCCC
GACAGCTGCCCGGTGGTGCTGCACAGCTTCACGCAGCTAGACCCCGACCTGCCGCGCCCG
GAGAGCTCCACGCAGGAGATCGGTGAGGAGCTGATCAACGGAGTCATCTACTCCATCTCC
CTGCGCAAGGTGCAGCTGCACCACGGAGGCAACAAGGGGCAGCGCTGGCTCGGGTATGAG
AATGAGTCGGCCCTGAACCTTTATGAGACTTGCAAGGTGCGGACCGTGAAGGCTGGCACG
CTGGAGAAGCTGGTGGAGCACCTGGTGCCAGCCTTCCAGGGCAGCGACCTCTCCTACGTC
ACCATCTTCCTGTGTACCTATAGAGCCTTCACCACCACCCAACAGGTCCTGGACCTGCTG
TTCAAAAGGTACGGTAGATGTGACGCCCTCACGGCCTCCTCTAGATACGGCTGCATCCTC
CCCTATTCCGACGAGGATGGTGGACCCCAGGACCAACTTAAAAATGCCATCTCCTCCATC
CTGGGCACCTGGCTGGACCAGTACTCGGAGGATTTCTGTCAACCTCCGGACTTTCCCTGC
CTCAAGCAGCTGGTGGCCTACGTGCAGCTCAACATGCCAGGCTCAGACCTGGAGCGCCGT
GCCCACCTTCTCCTGGCCCAGCTGGAGCACTCGGAACCCATTGAGGCAGAGCCTGAGGCT
CTGTCACCAGTGCCAGCTCTAAAACCAACTCCAGAGCTCGAGCTAGCTCTAACACCAGCT
CGAGCACCCAGCCCAGTGCCGGCTCCAGCCCCGGAGCCAGAGCCAGCTCCAACACCAGCT
CCAGGTTCAGAGCTAGAAGTAGCTCCAGCACCAGCTCCGGAGCTCCAGCAGGCTCCAGAG
CCAGCTGTGGGACTAGAATCGGCTCCAGCGCCAGCTCTGGAACTAGAGCCAGCTCCAGAA
CAGGATCCAGCTCCCTCACAAACTCTAGAGCTGGAGCCAGCTCCAGCACCAGTTCCATCA
TTACAGCCTTCCTGGCCTTCACCTGTGGTTGCAGAGAACGGGCTGAGTGAGGAGAAGCCT
CACCTCTTGGTGTTCCCTCCAGATCTGGTGGCAGAGCAGTTTACACTGATGGATGCGGAA
CTGTTCAAGAAGGTGGTGCCCTACCACTGCCTGGGCTCCATCTGGTCCCAGCGGGACAAG
AAGGGCAAGGAGCACCTGGCGCCCACCATCCGCGCCACTGTCACCCAGTTCAACAGTGTG
GCCAACTGTGTCATCACCACCTGCCTCGGGAACCGAAGCACGAAAGCCCCAGACAGGGCC
AGGGTGGTGGAGCACTGGATCGAGGTGGCCAGGGAGTGCCGGATCCTCAAGAACTTCTCG
TCACTGTATGCCATCCTCTCTGCCCTGCAGAGCAACTCCATCCACCGTCTGAAGAAGACG
TGGGAAGACGTTTCCAGGGACAGTTTCCGGATCTTTCAGAAGCTGTCAGAGATCTTCTCA
GATGAGAACAACTACTCATTGAGCCGGGAGCTGCTCATCAAGGAGGGCACCTCCAAGTTT
GCCACCCTGGAGATGAACCCCAAGAGAGCCCAGAAACGGCCGAAGGAGACGGGCATCATC
CAGGGCACCGTTCCCTACCTGGGCACGTTCCTCACCGACCTGGTGATGCTGGACACTGCC
ATGAAGGACTATCTGTATGGCAGACTCATCAACTTTGAGAAGAGGAGGAAGGAGTTCGAG
GTGATCGCCCAGATCAAGCTGCTGCAGTCGGCCTGCAACAACTACAGCATCGCGCCAGAT
GAGCAATTTGGGGCCTGGTTCCGGGCCGTGGAGCGGCTCAGCGAGACTGAGAGCTACAAC
CTGTCGTGCGAGCTGGAGCCCCCATCCGAGTCAGCCAGCAACACCCTCAGGACCAAGAAG
AACACAGCCATTGTCAAGCGCTGGAGCGACCGCCAGGCCCCCAGCACTGAGCTCAGTACC
AGTGGCAGCTCCCACTCCAAGTCCTGTGACCAGCTCAGGTGTGGCCCCTACCTCAGCAGC
GGGGACATCGCTGACGCGCTCAGCGTGCACTCGGCCGGCTCCTCTAGCTCCGACGTGGAG
GAGATCAACATCAGCTTCGTCCCGGAGTCTCCTGATGGCCAGGAAAAGAAGTTCTGGGAA
TCAGCCTCACAGTCATCCCCGGAGACCTCCGGCATCAGCTCAGCCTCCAGCAGCACCTCG
TCCTCCTCAGCCTCCACCACGCCCGTGGCTGCCACACGCACCCACAAGCGCTCTGTCTCA
GGGCTCTGCAACTCCAGCTCCGCGCTGCCGCTCTACAACCAGCAGGTGGGCGACTGCTGT
ATCATCCGCGTCAGCCTGGACGTGGACAATGGCAACATGTACAAGAGCATCCTGGTGACC
AGCCAAGATAAGGCTCCGGCTGTAATCCGCAAGGCCATGGACAAACACAACCTGGAGGAG
GAGGAGCCGGAGGACTATGAGCTGCTGCAGATTCTCTCAGATGACCGGAAGCTGAAGATC
CCTGAAAACGCCAACGTCTTCTATGCCATGAACTCTACCGCCAACTATGACTTTGTCCTC
AAGAAGCGGACCTTCACCAAGGGAGTGAAGGTCAAGCACGGAGCCAGCTCCACCCTCCCT
CGCATGAAGCAGAAAGGACTCAAGATTGCCAAGGGCATCTTCTGA
Protein Properties
Number of Residues 914
Molecular Weight 100605.7
Theoretical pI 5.45
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ral guanine nucleotide dissociation stimulator
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGGNKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHSEPIEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPEPEPAPTPA
PGSELEVAPAPAPELQQAPEPAVGLESAPAPALELEPAPEQDPAPSQTLELEPAPAPVPS
LQPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK
KGKEHLAPTIRATVTQFNSVANCVITTCLGNRSTKAPDRARVVEHWIEVARECRILKNFS
SLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKF
ATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFE
VIAQIKLLQSACNNYSIAPDEQFGAWFRAVERLSETESYNLSCELEPPSESASNTLRTKK
NTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVE
EINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVS
GLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE
EEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLP
RMKQKGLKIAKGIF
GenBank ID Protein 24307909
UniProtKB/Swiss-Prot ID Q12967
UniProtKB/Swiss-Prot Entry Name GNDS_HUMAN
PDB IDs
GenBank Gene ID NM_006266.2
GeneCard ID RALGDS
GenAtlas ID RALGDS
HGNC ID HGNC:9842
References
General References
  1. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  5. Humphrey D, Kwiatkowska J, Henske EP, Haines JL, Halley D, van Slegtenhorst M, Kwiatkowski DJ: Cloning and evaluation of RALGDS as a candidate for the tuberous sclerosis gene TSC1. Ann Hum Genet. 1997 Jul;61(Pt 4):299-305. [PubMed:9365783 ]
  6. Hofer F, Fields S, Schneider C, Martin GS: Activated Ras interacts with the Ral guanine nucleotide dissociation stimulator. Proc Natl Acad Sci U S A. 1994 Nov 8;91(23):11089-93. [PubMed:7972015 ]
  7. Geyer M, Herrmann C, Wohlgemuth S, Wittinghofer A, Kalbitzer HR: Structure of the Ras-binding domain of RalGEF and implications for Ras binding and signalling. Nat Struct Biol. 1997 Sep;4(9):694-9. [PubMed:9302994 ]