Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08436
Secondary Accession Numbers
  • 14148
Name Golgin subfamily A member 5
Synonyms
  1. Cell proliferation-inducing gene 31 protein
  2. Golgin-84
  3. Protein Ret-II
  4. RET-fused gene 5 protein
Gene Name GOLGA5
Protein Type Unknown
Biological Properties
General Function Replication, recombination and repair
Specific Function Involved in maintaining Golgi structure. Stimulates the formation of Golgi stacks and ribbons. Involved in intra-Golgi retrograde transport
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type IV membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 14q
SNPs GOLGA5
Gene Sequence
>2196 bp
ATGTCTTGGTTTGTTGATCTTGCTGGAAAGGCAGAAGATCTTTTAAACCGAGTTGATCAA
GGGGCTGCAACAGCTCTCAGTAGGAAAGACAATGCCAGCAACATATATAGCAAAAATACT
GACTATACTGAACTTCACCAGCAAAATACAGATTTGATATATCAGACTGGACCTAAATCT
ACGTATATTTCATCAGCAGCTGATAACATTCGAAATCAAAAAGCCACCATCTTAGCTGGC
ACTGCAAATGTGAAAGTAGGATCTCGGACACCAGTAGAGGCCTCTCATCCTGTTGAAAAT
GCATCTGTTCCTAGGCCTTCATCCCATTTTGTGCGAAGAAAAAAGTCAGAACCTGATGAT
GAGCTGCTGTTTGATTTTCTTAATAGTTCACAGAAGGAGCCTACCGGGAGGGTGGAAATC
AGAAAGGAAAAAGGCAAGACACCTGTCTTTCAGAGCTCTCAGACATCAAGTGTCAGTTCT
GTGAACCCCAGTGTAACCACCATCAAAACCATTGAAGAAAATTCTTTTGGGAGCCAAACC
CACGAAGCTGCCAGTAACTCAGATTCTAGCCATGAAGGTCAAGAGGAATCTTCAAAGGAA
AATGTGTCATCAAATGCTGCCTGCCCTGACCACACCCCAACACCTAATGATGATGGCAAA
TCACATGAACTGTCTAACCTTCGACTGGAGAATCAGCTGCTGAGGAATGAAGTTCAGTCT
TTAAATCAAGAAATGGCCTCGTTACTCCAAAGATCCAAAGAGACTCAAGAAGAATTAAAC
AAAGCAAGAGCAAGAGTTGAAAAGTGGAATGCTGACCATTCAAAGAGTGATCGAATGACT
CGAGGACTCCGAGCCCAAGTAGATGACCTGACTGAAGCTGTGGCTGCAAAGGATTCCCAG
CTGGCTGTACTGAAAGTGAGACTCCAGGAAGCTGACCAGCTACTGAGTACTCGCACAGAA
GCATTAGAAGCCTTACAGAGTGAAAAATCACGAATAATGCAGGATCAAAGTGAAGGTAAC
AGCCTGCAGAATCAAGCTCTGCAGACTCTTCAGGAGAGACTGCATGAAGCGGATGCCACT
CTGAAGAGAGAGCAGGAGAGCTATAAACAGATGCAGAGCGAGTTTGCTGCACGCCTTAAT
AAAGTGGAAATGGAACGTCAGAATTTAGCAGAAGCAATTACACTGGCCGAAAGAAAATAC
TCAGATGAGAAGAAGAGGGTTGATGAACTGCAGCAGCAAGTCAAGCTGTATAAGTTGAAC
TTGGAGTCCTCTAAGCAGGAATTAATTGACTACAAGCAAAAAGCTACTAGAATACTGCAA
TCTAAGGAAAAATTGATTAACAGCTTGAAAGAAGGCTCTGGTTTTGAAGGCCTAGATAGC
AGCACTGCCAGTAGCATGGAGCTGGAAGAACTTCGGCATGAGAAAGAGATGCAGAGGGAG
GAAATACAGAAGCTGATGGGCCAGATACATCAGCTCAGATCCGAATTACAGGATATGGAG
GCACAGCAAGTTAATGAAGCAGAATCAGCAAGAGAACAGTTACAGGATCTGCATGACCAA
ATAGCTGGGCAGAAAGCATCCAAACAAGAACTAGAGACAGAACTGGAGCGACTGAAGCAG
GAGTTCCACTATATAGAAGAAGATCTTTATCGAACAAAGAACACATTGCAAAGCAGAATT
AAAGATCGAGACGAAGAAATTCAAAAACTCAGGAATCAGCTTACCAATAAAACTTTAAGC
AATAGCAGTCAGTCTGAGTTAGAAAATCGACTCCATCAGCTAACAGAGACTCTCATCCAG
AAACAGACCATGCTGGAGAGTCTCAGCACAGAAAAGAACTCCCTGGTCTTTCAACTGGAG
CGCCTCGAACAGCAGATGAACTCCGCCTCTGGAAGTAGTAGTAATGGGTCTTCGATTAAT
ATGTCTGGAATTGACAATGGTGAAGGCACTCGTCTGCGAAATGTTCCTGTTCTTTTTAAT
GACACAGAAACTAATCTGGCAGGAATGTACGGAAAAGTTCGCAAAGCTGCTAGTTCAATT
GATCAGTTTAGTATTCGCCTGGGAATTTTTCTCCGAAGATACCCCATAGCGCGAGTTTTT
GTAATTATATATATGGCTTTGCTTCACCTCTGGGTCATGATTGTTCTGTTGACTTACACA
CCAGAAATGCACCACGACCAACCATATGGCAAATGA
Protein Properties
Number of Residues 731
Molecular Weight 83023.7
Theoretical pI 5.62
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 699-719
Protein Sequence
>Golgin subfamily A member 5
MSWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNTDLIYQTGPKS
TYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVENASVPRPSSHFVRRKKSEPDD
ELLFDFLNSSQKEPTGRVEIRKEKGKTPVFQSSQTSSVSSVNPSVTTIKTIEENSFGSQT
HEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQS
LNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQ
LAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADAT
LKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLN
LESSKQELIDYKQKATRILQSKEKLINSLKEGSGFEGLDSSTASSMELEELRHEKEMQRE
EIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQ
EFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQSELENRLHQLTETLIQ
KQTMLESLSTEKNSLVFQLERLEQQMNSASGSSSNGSSINMSGIDNGEGTRLRNVPVLFN
DTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYT
PEMHHDQPYGK
GenBank ID Protein 4191344
UniProtKB/Swiss-Prot ID Q8TBA6
UniProtKB/Swiss-Prot Entry Name GOGA5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF085199
GeneCard ID GOLGA5
GenAtlas ID GOLGA5
HGNC ID HGNC:4428
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  6. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  7. Ishizaka Y, Ochiai M, Tahira T, Sugimura T, Nagao M: Activation of the ret-II oncogene without a sequence encoding a transmembrane domain and transforming activity of two ret-II oncogene products differing in carboxy-termini due to alternative splicing. Oncogene. 1989 Jun;4(6):789-94. [PubMed:2734021 ]
  8. Bascom RA, Srinivasan S, Nussbaum RL: Identification and characterization of golgin-84, a novel Golgi integral membrane protein with a cytoplasmic coiled-coil domain. J Biol Chem. 1999 Jan 29;274(5):2953-62. [PubMed:9915833 ]
  9. Klugbauer S, Demidchik EP, Lengfelder E, Rabes HM: Detection of a novel type of RET rearrangement (PTC5) in thyroid carcinomas after Chernobyl and analysis of the involved RET-fused gene RFG5. Cancer Res. 1998 Jan 15;58(2):198-203. [PubMed:9443391 ]
  10. Diao A, Rahman D, Pappin DJ, Lucocq J, Lowe M: The coiled-coil membrane protein golgin-84 is a novel rab effector required for Golgi ribbon formation. J Cell Biol. 2003 Jan 20;160(2):201-12. Epub 2003 Jan 21. [PubMed:12538640 ]
  11. Malsam J, Satoh A, Pelletier L, Warren G: Golgin tethers define subpopulations of COPI vesicles. Science. 2005 Feb 18;307(5712):1095-8. [PubMed:15718469 ]