Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08439
Secondary Accession Numbers
  • 14151
Name GTP-binding protein 2
Synonyms Not Available
Gene Name GTPBP2
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:6
Locus 6p21
SNPs GTPBP2
Gene Sequence
>1809 bp
ATGGACTCGCGGGTATCGGAGCTGTTCGGCGGCTGCTGCCGGCCCGGAGGGGGCCCGGCC
GTGGGCGGAACCCTCAAGGCTAGGGGGGCCGGCAGCAGCAGCGGCTGCGGGGGGCCAAAG
GGAAAGAAGAAGAACGGAAGGAACAGAGGGGGCAAAGCCAACAACCCCCCGTATTTGCCC
CCCGAGGCTGAAGATGGAAACATTGAATATAAATTGAAGCTGGTGAATCCATCCCAGTAC
CGCTTTGAGCACCTGGTGACACAAATGAAGTGGCGGCTCCAGGAGGGACGTGGTGAGGCC
GTCTACCAGATTGGGGTAGAGGACAATGGGCTGCTGGTGGGGCTGGCTGAGGAGGAAATG
CGAGCTTCGCTCAAGACCCTGCACCGGATGGCAGAGAAGGTTGGGGCAGACATAACCGTT
CTTCGAGAGCGAGAAGTGGATTATGATAGCGACATGCCCCGGAAGATCACCGAGGTGCTA
GTACGAAAGGTCCCTGACAACCAACAGTTCCTAGACCTCCGTGTGGCCGTCCTGGGGAAT
GTGGACTCTGGGAAGTCAACTCTGCTTGGAGTCCTGACCCAGGGAGAGCTGGACAATGGG
CGGGGCCGGGCTCGGCTCAACCTTTTCCGCCACCTGCATGAGATTCAGTCTGGCCGAACC
TCCAGCATCAGCTTCGAGATCCTGGGCTTTAACAGCAAGGGAGAGGTGGTGAATTACAGC
GACTCACGGACAGCAGAAGAGATCTGTGAGAGCAGCTCCAAGATGATCACCTTCATCGAC
CTGGCAGGCCACCATAAGTACCTACACACCACCATCTTTGGCCTCACATCATACTGCCCC
GACTGCGCCCTGCTCCTCGTCAGTGCCAACACTGGGATTGCTGGCACCACAAGGGAACAT
CTGGGGCTGGCCCTGGCCCTGAAAGTGCCCTTCTTCATCGTGGTCAGCAAGATCGACCTA
TGTGCCAAGACCACAGTGGAGAGGACAGTACGCCAGCTGGAGCGGGTCCTCAAGCAGCCT
GGCTGCCACAAGGTCCCCATGCTGGTCACCTCTGAGGATGATGCCGTCACTGCTGCCCAG
CAGTTTGCTCAGTCACCCAATGTCACCCCCATCTTCACATTGTCCAGTGTGTCTGGAGAG
AGTCTGGACCTCCTCAAAGTCTTTCTGAATATTCTGCCGCCACTCACCAACAGCAAAGAG
CAGGAGGAACTCATGCAGCAGCTGACGGAGTTCCAGGTGGATGAAATCTACACAGTACCA
GAGGTGGGGACTGTTGTTGGAGGAACACTTTCCAGTGGGATTTGCCGTGAGGGGGACCAG
CTGGTGGTGGGCCCCACGGATGATGGCTGCTTCCTGGAGCTGAGAGTATGCAGCATCCAG
CGCAACCGCTCTGCCTGTCGTGTGCTGCGAGCTGGTCAGGCTGCTACACTGGCGCTTGGG
GACTTTGACCGTGCACTGCTTCGCAAGGGCATGGTGATGGTGAGCCCGGAGATGAATCCT
ACCATCTGCTCGGTGTTTGAGGCAGAGATAGTCTTACTGTTCCATGCCACCACCTTCCGA
CGAGGATTCCAGGTGACAGTACACGTGGGCAACGTACGTCAGACGGCAGTGGTGGAAAAG
ATCCATGCCAAGGACAAACTGCGGACAGGCGAGAAGGCAGTGGTACGTTTCCGCTTCCTG
AAACACCCAGAGTACCTGAAGGTGGGCGCCAAACTGCTGTTCCGGGAGGGTGTCACCAAG
GGCATCGGCCATGTCACTGATGTACAAGCCATTACAGCAGGAGAAGCCCAGGCCAACATG
GGCTTCTGA
Protein Properties
Number of Residues 602
Molecular Weight 65768.0
Theoretical pI 8.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>GTP-binding protein 2
MDSRVSELFGGCCRPGGGPAVGGTLKARGAGSSSGCGGPKGKKKNGRNRGGKANNPPYLP
PEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEM
RASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLDLRVAVLGN
VDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS
DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREH
LGLALALKVPFFIVVSKIDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQ
QFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQVDEIYTVP
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALG
DFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEK
IHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANM
GF
GenBank ID Protein 45593140
UniProtKB/Swiss-Prot ID Q9BX10
UniProtKB/Swiss-Prot Entry Name GTPB2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019096.3
GeneCard ID GTPBP2
GenAtlas ID GTPBP2
HGNC ID HGNC:4670
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Watanabe M, Yoshida K, Hida M, Kato H, Uchida K, Yamaguchi R, Tateyama S, Sugano S: Cloning, expression analysis, and chromosomal mapping of GTPBP2, a novel member of the G protein family. Gene. 2000 Oct 3;256(1-2):51-8. [PubMed:11054535 ]
  6. Kudo H, Senju S, Mitsuya H, Nishimura Y: Mouse and human GTPBP2, newly identified members of the GP-1 family of GTPase. Biochem Biophys Res Commun. 2000 Jun 7;272(2):456-65. [PubMed:10833435 ]