Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08451
Secondary Accession Numbers
  • 14163
Name Eukaryotic translation initiation factor 2 subunit 3
Synonyms
  1. Eukaryotic translation initiation factor 2 subunit gamma X
  2. eIF-2-gamma X
  3. eIF-2gX
Gene Name EIF2S3
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activity
Specific Function eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B
Pathways Not Available
Reactions Not Available
GO Classification
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs EIF2S3
Gene Sequence
>1419 bp
ATGGCGGGCGGAGAAGCTGGAGTGACTCTAGGGCAGCCGCATCTTTCGCGTCAGGATCTC
ACCACCTTGGATGTTACCAAGTTGACGCCACTTTCACATGAAGTTATCAGCAGACAAGCC
ACAATTAACATAGGTACAATTGGTCATGTAGCTCATGGGAAATCCACAGTCGTCAAAGCT
ATTTCTGGAGTTCATACTGTCAGGTTCAAAAATGAACTAGAAAGAAATATTACAATCAAG
CTTGGATATGCTAATGCTAAGATTTATAAGCTTGATGACCCAAGTTGCCCTCGGCCAGAA
TGTTATAGATCTTGTGGGAGCAGTACACCTGACGAGTTTCCTACGGACATTCCAGGGACC
AAAGGGAACTTCAAATTAGTCAGACATGTTTCCTTTGTTGACTGTCCTGGCCACGATATT
TTGATGGCTACTATGCTGAACGGTGCAGCAGTGATGGATGCAGCTCTTCTGTTGATAGCT
GGTAATGAATCTTGCCCTCAGCCTCAGACATCGGAACACCTGGCTGCTATAGAGATCATG
AAACTGAAGCATATTTTGATTCTACAAAATAAAATTGATTTGGTAAAAGAAAGTCAGGCT
AAAGAACAATACGAGCAGATCCTTGCATTTGTCCAAGGTACAGTAGCAGAGGGAGCTCCC
ATTATTCCAATTTCAGCTCAGCTGAAATACAATATTGAAGTTGTTTGTGAGTACATAGTA
AAGAAAATTCCAGTACCCCCAAGAGACTTTACTTCAGAGCCCCGGCTTATTGTTATTAGA
TCTTTTGATGTCAACAAACCTGGCTGTGAAGTTGATGACCTTAAGGGAGGTGTAGCTGGT
GGTAGTATCCTAAAAGGAGTATTAAAGGTGGGCCAGGAGATAGAAGTAAGACCTGGTATT
GTTTCCAAAGATAGTGAAGGAAAACTCATGTGTAAACCAATCTTTTCCAAAATTGTATCA
CTTTTTGCGGAGCATAATGATCTGCAATATGCTGCTCCAGGCGGTCTTATTGGAGTTGGA
ACAAAAATTGACCCCACTTTGTGCCGGGCTGACAGAATGGTGGGGCAAGTACTTGGTGCA
GTCGGAGCTTTACCTGAGATATTCACAGAATTGGAAATTTCCTATTTCCTGCTTAGACGG
CTTCTAGGTGTACGCACTGAAGGAGACAAGAAAGCAGCAAAGGTTCAAAAGCTGTCTAAG
AATGAAGTGCTCATGGTGAACATAGGATCCCTGTCAACAGGAGGGAGAGTTAGTGCTGTC
AAGGCCGATTTGGGTAAAATTGTTTTGACCAATCCAGTGTGCACAGAGGTAGGAGAAAAA
ATTGCCCTTAGCCGAAGAGTTGAAAAACACTGGCGTTTAATTGGTTGGGGTCAGATAAGA
AGAGGAGTGACAATCAAGCCAACAGTAGATGATGACTGA
Protein Properties
Number of Residues 472
Molecular Weight 51109.1
Theoretical pI 8.54
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Eukaryotic translation initiation factor 2 subunit 3
MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKA
ISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGT
KGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIM
KLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIV
KKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGI
VSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGA
VGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAV
KADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P41091
UniProtKB/Swiss-Prot Entry Name IF2G_HUMAN
PDB IDs Not Available
GenBank Gene ID L19161
GeneCard ID EIF2S3
GenAtlas ID EIF2S3
HGNC ID HGNC:3267
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [PubMed:19054851 ]
  4. Gaspar NJ, Kinzy TG, Scherer BJ, Humbelin M, Hershey JW, Merrick WC: Translation initiation factor eIF-2. Cloning and expression of the human cDNA encoding the gamma-subunit. J Biol Chem. 1994 Feb 4;269(5):3415-22. [PubMed:8106381 ]