You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08456
Secondary Accession Numbers
  • 14168
Name Importin subunit alpha-1
Synonyms
  1. Karyopherin subunit alpha-1
  2. NPI-1
  3. Nucleoprotein interactor 1
  4. RAG cohort protein 2
  5. SRP1-beta
Gene Name KPNA1
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non- classical NLS
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
nuclear pore
organelle part
intracellular organelle part
nuclear part
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
protein import into nucleus
intracellular protein transport
protein targeting
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21
SNPs KPNA1
Gene Sequence
>1617 bp
ATGACCACCCCAGGAAAAGAGAACTTTCGCCTGAAAAGTTACAAGAACAAATCTCTGAAT
CCCGATGAGATGCGCAGGAGGAGGGAGGAAGAAGGACTGCAGTTACGAAAGCAGAAAAGA
GAAGAGCAGTTATTCAAGCGGAGAAATGTTGCTACAGCAGAAGAAGAAACAGAAGAAGAA
GTTATGTCAGATGGAGGCTTTCATGAGGCTCAGATTAGTAACATGGAGATGGCACCAGGT
GGTGTCATCACTTCTGACATGATTGAAATGATATTTTCCAAAAGCCCAGAGCAACAGCTT
TCAGCAACACAGAAATTCAGGAAGCTGCTTTCAAAAGAACCTAACCCTCCTATTGATGAA
GTTATCAGCACACCAGGAGTAGTGGCCAGGTTTGTGGAGTTCCTCAAACGAAAAGAGAAT
TGTACACTGCAGTTTGAATCAGCTTGGGTACTGACAAATATTGCTTCAGGAAATTCTCTT
CAGACCCGAATTGTGATTCAGGCAGGAGCTGTGCCCATCTTCATAGAGTTGCTCAGCTCA
GAGTTTGAAGATGTCCAGGAACAGGCAGTCTGGGCTCTTGGCAACATTGCTGGAGATAGT
ACCATGTGCAGGGACTATGTCTTAGACTGCAATATCCTTCCCCCTCTTTTGCAGTTATTT
TCAAAGCAAAACCGCCTGACCATGACCCGGAATGCAGTATGGGCTTTGTCTAATCTCTGT
AGAGGGAAAAGTCCACCTCCAGAATTTGCAAAGGTTTCTCCATGTCTGAATGTGCTTTCC
TGGTTGCTGTTTGTCAGTGACACTGATGTACTGGCTGATGCCTGCTGGGCCCTCTCATAT
CTATCAGATGGACCCAATGATAAAATTCAAGCGGTCATCGATGCGGGAGTATGTAGGAGA
CTTGTGGAACTGCTGATGCATAATGATTATAAAGTGGTTTCTCCTGCTTTGCGAGCTGTG
GGAAACATTGTCACAGGGGATGATATTCAGACACAGGTAATTCTGAATTGCTCAGCTCTG
CAGAGTTTATTGCATTTGCTGAGTAGCCCAAAGGAATCTATCAAAAAGGAAGCATGTTGG
ACGATATCTAATATTACAGCTGGAAATAGGGCACAGATCCAGACTGTGATAGATGCCAAC
ATTTTCCCAGCCCTCATTAGTATTTTACAAACTGCTGAATTTCGGACAAGAAAAGAAGCA
GCTTGGGCCATCACAAATGCAACTTCTGGAGGATCAGCTGAACAGATCAAGTACCTAGTA
GAACTGGGTTGTATCAAGCCGCTCTGTGATCTCCTCACGGTCATGGACTCTAAGATTGTA
CAGGTTGCCCTAAATGGCTTGGAAAATATCCTGAGGCTTGGAGAACAGGAAGCCAAAAGG
AATGGCACTGGCATTAACCCTTACTGTGCTTTGATTGAAGAAGCTTATGGTCTGGATAAA
ATTGAGTTCTTACAGAGTCATGAAAACCAGGAGATCTACCAAAAGGCCTTTGATCTTATT
GAGCATTACTTCGGGACCGAAGATGAAGACAGCAGCATTGCACCCCAGGTTGACCTTAAC
CAGCAGCAGTACATCTTCCAACAGTGTGAGGCTCCTATGGAAGGTTTCCAGCTTTGA
Protein Properties
Number of Residues 538
Molecular Weight 60221.2
Theoretical pI 4.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Importin subunit alpha-1
MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEE
VMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDE
VISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSS
EFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLC
RGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACW
TISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLV
ELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDK
IEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
GenBank ID Protein 222144293
UniProtKB/Swiss-Prot ID P52294
UniProtKB/Swiss-Prot Entry Name IMA1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_002264.3
GeneCard ID KPNA1
GenAtlas ID KPNA1
HGNC ID HGNC:6394
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  3. O'Neill RE, Palese P: NPI-1, the human homolog of SRP-1, interacts with influenza virus nucleoprotein. Virology. 1995 Jan 10;206(1):116-25. [PubMed:7831767 ]
  4. Cortes P, Ye ZS, Baltimore D: RAG-1 interacts with the repeated amino acid motif of the human homologue of the yeast protein SRP1. Proc Natl Acad Sci U S A. 1994 Aug 2;91(16):7633-7. [PubMed:8052633 ]
  5. Moroianu J, Blobel G, Radu A: Previously identified protein of uncertain function is karyopherin alpha and together with karyopherin beta docks import substrate at nuclear pore complexes. Proc Natl Acad Sci U S A. 1995 Mar 14;92(6):2008-11. [PubMed:7892216 ]
  6. Moroianu J, Blobel G, Radu A: The binding site of karyopherin alpha for karyopherin beta overlaps with a nuclear localization sequence. Proc Natl Acad Sci U S A. 1996 Jun 25;93(13):6572-6. [PubMed:8692858 ]
  7. Moroianu J, Hijikata M, Blobel G, Radu A: Mammalian karyopherin alpha 1 beta and alpha 2 beta heterodimers: alpha 1 or alpha 2 subunit binds nuclear localization signal and beta subunit interacts with peptide repeat-containing nucleoporins. Proc Natl Acad Sci U S A. 1995 Jul 3;92(14):6532-6. [PubMed:7604027 ]
  8. Popov S, Rexach M, Zybarth G, Reiling N, Lee MA, Ratner L, Lane CM, Moore MS, Blobel G, Bukrinsky M: Viral protein R regulates nuclear import of the HIV-1 pre-integration complex. EMBO J. 1998 Feb 16;17(4):909-17. [PubMed:9463369 ]
  9. Lischka P, Sorg G, Kann M, Winkler M, Stamminger T: A nonconventional nuclear localization signal within the UL84 protein of human cytomegalovirus mediates nuclear import via the importin alpha/beta pathway. J Virol. 2003 Mar;77(6):3734-48. [PubMed:12610148 ]
  10. Reid SP, Leung LW, Hartman AL, Martinez O, Shaw ML, Carbonnelle C, Volchkov VE, Nichol ST, Basler CF: Ebola virus VP24 binds karyopherin alpha1 and blocks STAT1 nuclear accumulation. J Virol. 2006 Jun;80(11):5156-67. [PubMed:16698996 ]
  11. Simkus C, Makiya M, Jones JM: Karyopherin alpha 1 is a putative substrate of the RAG1 ubiquitin ligase. Mol Immunol. 2009 Apr;46(7):1319-25. doi: 10.1016/j.molimm.2008.11.009. Epub 2008 Dec 31. [PubMed:19118899 ]