You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08458
Secondary Accession Numbers
  • 14170
Name Importin subunit alpha-3
Synonyms
  1. Importin alpha Q2
  2. Karyopherin subunit alpha-3
  3. Qip2
  4. SRP1-gamma
Gene Name KPNA3
Protein Type Unknown
Biological Properties
General Function Involved in binding
Specific Function Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non- classical NLS. Recognizes NLSs of influenza A virus nucleoprotein probably through ARM repeats 7-9
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
nuclear pore
organelle part
intracellular organelle part
nuclear part
Function
binding
protein transporter activity
transporter activity
substrate-specific transporter activity
Process
establishment of localization
transport
protein transport
protein import into nucleus
intracellular protein transport
protein targeting
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 13q14.3
SNPs KPNA3
Gene Sequence
>1566 bp
ATGGCCGAGAACCCCAGCTTGGAGAACCACCGCATCAAGAGCTTCAAGAACAAGGGCCGC
GATGTGGAAACAATGCGAAGACATAGAAATGAAGTGACAGTGGAACTGCGGAAGAACAAA
AGAGATGAACACTTATTGAAAAAGAGAAATGTTCCCCAAGAAGAAAGTCTAGAAGATTCA
GATGTTGATGCTGATTTTAAAGCACAAAATGTAACCCTAGAAGCTATATTGCAGAATGCC
ACAAGTGATAACCCAGTGGTCCAATTGAGTGCTGTCCAGGCAGCAAGAAAACTGTTATCC
AGTGACAGAAATCCACCGATTGATGACTTAATAAAATCTGGGATTTTACCAATTCTAGTC
AAATGTCTAGAAAGGGATGATAATCCTTCATTACAGTTTGAAGCTGCTTGGGCATTAACT
AACATAGCATCAGGAACTTCTGCACAGACTCAAGCTGTTGGGCAGTCTAATGCAGTACCT
CTTTTTCTGAGACTTCTTCGTTCACCACATCAGAATGTTTGTGAACAAGCAGTATGGGCT
TTGGGAAACATAATAGGTGATGGTCCTCAATGTAGAGATTATGTCATATCACTGGGAGTT
GTCAAACCTCTTCTGTCCTTCATCAGCCCCTCCATCCCCATCACCTTCCTTCGGAACGTC
ACATGGGTCATTGTCAATCTCTGCAGGAATAAGGATCCCCCACCGACTATGGAGACAGTT
CAGGAGATTTTACCAGCTTTATGTGTCCTCATATACCATACAGATATAAACATTCTTGTA
GACACTGTTTGGGCTCTGTCATACTTGACAGATGGAGGTAATGAACAGATACAGATGGTT
ATTGATTCAGGAGTTGTGCCCTTTCTTGTGCCCCTTCTGAGCCATCAGGAAGTCAAAGTT
CAAACAGCAGCCCTCAGAGCAGTTGGCAACATAGTGACTGGCACCGACGAGCAGACCCAG
GTTGTTCTCAATTGTGATGTCCTGTCACACTTCCCAAATCTCTTATCACACCCAAAAGAG
AAGATAAATAAGGAAGCAGTGTGGTTCCTTTCCAACATAACAGCAGGCAACCAGCAACAA
GTTCAAGCTGTAATAGATGCTGGATTAATTCCTATGATAATTCATCAGCTTGCTAAGGGG
GACTTTGGAACACAAAAAGAAGCTGCTTGGGCAATCAGCAACTTAACAATAAGTGGCAGA
AAAGATCAGGTTGAGTACCTTGTACAGCAGAATGTAATACCACCGTTCTGTAATTTACTG
TCAGTGAAAGATTCTCAAGTGGTTCAGGTGGTTCTAGATGGTCTAAAAAACATTCTGATA
ATGGCCGGTGATGAAGCAAGCACAATAGCTGAAATAATAGAGGAATGTGGAGGTTTGGAG
AAAATTGAAGTTTTACAGCAACATGAAAATGAAGACATATATAAATTAGCATTTGAAATC
ATAGATCAGTATTTCTCTGGTGATGATATTGATGAAGATCCCTGCCTCATTCCTGAAGCA
ACACAAGGAGGTACCTACAATTTTGATCCAACAGCCAACCTTCAAACAAAAGAATTTAAT
TTTTAA
Protein Properties
Number of Residues 521
Molecular Weight 57810.4
Theoretical pI 4.55
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Importin subunit alpha-3
MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDS
DVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILV
KCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWA
LGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIVNLCRNKDPPPPMETV
QEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKV
QTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQ
VQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLL
SVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEVLQQHENEDIYKLAFEI
IDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF
GenBank ID Protein 2654139
UniProtKB/Swiss-Prot ID O00505
UniProtKB/Swiss-Prot Entry Name IMA3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF034756
GeneCard ID KPNA3
GenAtlas ID KPNA3
HGNC ID HGNC:6396
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  7. Takeda S, Fujiwara T, Shimizu F, Kawai A, Shinomiya K, Okuno S, Ozaki K, Katagiri T, Shimada Y, Nagata M, Watanabe T, Takaichi A, Kuga Y, Suzuki M, Hishigaki H, Takahashi E, Shin S, Nakamura Y, Hirai Y: Isolation and mapping of karyopherin alpha 3 (KPNA3), a human gene that is highly homologous to genes encoding Xenopus importin, yeast SRP1 and human RCH1. Cytogenet Cell Genet. 1997;76(1-2):87-93. [PubMed:9154134 ]
  8. Kohler M, Ansieau S, Prehn S, Leutz A, Haller H, Hartmann E: Cloning of two novel human importin-alpha subunits and analysis of the expression pattern of the importin-alpha protein family. FEBS Lett. 1997 Nov 3;417(1):104-8. [PubMed:9395085 ]
  9. Nachury MV, Ryder UW, Lamond AI, Weis K: Cloning and characterization of hSRP1 gamma, a tissue-specific nuclear transport factor. Proc Natl Acad Sci U S A. 1998 Jan 20;95(2):582-7. [PubMed:9435235 ]
  10. Melen K, Fagerlund R, Franke J, Kohler M, Kinnunen L, Julkunen I: Importin alpha nuclear localization signal binding sites for STAT1, STAT2, and influenza A virus nucleoprotein. J Biol Chem. 2003 Jul 25;278(30):28193-200. Epub 2003 May 9. [PubMed:12740372 ]